TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T08641 XX ID T08641 XX DT 08.03.2006 (created); man. DT 23.10.2013 (updated); spk. CO Copyright (C), QIAGEN. XX FA NCOR1-isoform1 XX SY N-COR; N-COR1; NCOR1; nuclear receptor co-repressor; retinoid X receptor interacting protein 13; RXRIP13. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G002796 Ncor1. XX CL C0022; trp. XX SZ 2453 AA; 270.6 kDa (cDNA) (calc.). XX SQ MSSSGYPPNQGAFSTEQSRYPSHSVQYTFPSARHQQEFAVPDYRSSHLEVSQASQLLQQQ SQ QQQQLRRRPSLLSEFHPGSDRPQERRSGYEQFHPGPSPVDHDSLESKRPRLEQVSDSHFQ SQ RISAAVLPLVHTLPEGLRSSANAKKDPAFGVKHEAPSSPLSGQPCGDDQNASPSKLSKEE SQ LIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIY SQ DENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTNQVMRKKLILFFKRRNHAR SQ KQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQ SQ RVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFINM SQ NGLMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYYL SQ TKKNENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKKDDEEKDD SQ KEDSKETTKEKDRTEATAEEPEEREQVTPRGRKTANSQGRGKGRVTRSMTSEAAAANAAA SQ AATEEPPPPLPPPPEPISTEPVETSRWTEEEMEVAKKGLVEHGRNWAAIAKMVGTKSEAQ SQ CKNFYFNYKRRHNLDNLLQQHKQKASRKPREERDVSQCESVASTVSAQEDEDIEASNEEE SQ NPEDSEGAENSSDTESAPSPSPVEAAKSSEDSSENAASRGNTEPVAELEATTDPAPCASP SQ SSAVPTTKPAERESVEAQVTDSASAETAEPMDVDHEECGAEGSSVLDPPAPTKADSVDPE SQ MQVPENTASKGEGDAKERDLESTSEKTEARDEDVVVAEQIERPEPQSDDDSSATCSADEG SQ VDGEPERQRVFPMDAKPSLLTPPGSILISSPIKPNLLDLPQLQHRAAVIPPMVSCTPCNI SQ PIGTPVSGYALYQRHIKAMHESALLEEQRQRQEQVDLECRSSTSPCSTSKSPNREWEVLQ SQ PAPHQVITNLPEGVRLPTTRPTRPPPPLIPSSKTTVASEKPSFIMGGSISQGTPGTYLSS SQ HNQAYPQEAPKPSVGSISLGLPRQQESTKAAPLTYIKQEEFSPRSQNSQPEGLLVRAQHE SQ GVVRGTAGAVQEGSITRGTPASKISVETISSLRGSITQGTPALPQAGIPTEALVKGPVSR SQ MPIEESSPEKVREEAASKGHVIYEGKSGHILSYDNIKNAREGTRSPRTAHEMSLKRSYEA SQ VEGSIKQGMSMRESPVSAPLEGLICRALPRGSPHSDLKERTVLSGSIMQGTPRATAESFE SQ DGLKYPKQIKRESPPIRAFEGAITKGKPYDGITTIKEMGRSIHEIPRQDILTQESRKTPE SQ VVQSTRPIIEGSISQGTPIKFDNNSGQSAIKHNVKSLITGPSKLPRGMLEIVPENIKVVE SQ RGKYEDVKAGEPVRARHTSVVSSGPSVLRSTLHEAPKAQLSPGLYDDSSARRTPVSYQNT SQ ISRGSPMMNRTSDVSSSKSASHERKSTLTPTQRESIPAKSPVPGVDPIVSHSPFDPHHRS SQ SAAGEVYRSHLPTHLDPAMPFHRALDPAAAYLLQRQLSPTPGYPSQYQLYAMENTRQTIL SQ NDYITSQQMQVNLRPDVTRGLSPREQPLGLPYPATRGIIDLTNMPPTILVPHAGGTSTPP SQ MDRITYIPGTQVTFPPRPYNAASLSPGHPTHLAAAASAEREREREREKERERERERERER SQ ERERIAAAPADLYLRPGSEQPGRPGSHGYVRSPSPSVRTQETILQQRPSVFQGTNGTSVI SQ TPLDPTAQLRIMPLPSGGPSISQGLPASRYNTAADALAALVDAAASAPQMDVSKTKESKH SQ EAARLEENLRSRSAAVSEQQQLEQKNLEVEKRSVQCVCTSSALPSGKAQPHASVVYSEAG SQ KDKGPPPKSRYEEELRTRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSSSLSSH SQ RYETASDAIEVISPASSPAPPQEKPQAYQPDMVKANQAENESTRQYEGPLHHYRSQQESP SQ SPQQQPPLPPSSQSEGMGQVPRTHRLITLADHICQIITQDFARNQVPSQASTSTFQTSPS SQ ALSSTPVRTKTSSRYSPESQSQTVLHPRPGPRVSPENLVDKSRGSRPGKSPERSHIPSEP SQ YEPISPPQGPAVHEKQDSMLLLSQRGVDPAEQRSDSRSPGSISYLPSFFTKLESTSPMVK SQ SKKQEIFRKLNSSGGGDSDMAAAQPGTEIFNLPAVTTSGAVSSRSHSFADPASNLGLEDI SQ IRKALMGSFDDKVEDHGVVMSHPVGIMPGSASTSVVTSSEARRDEGEPSPHAGVCKPKLI SQ NKSNSRKSKSPIPGQSYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYNP SQ LTIRMLSSTPPTQIACAPSAITQAAPHQQNRIWEREPAPLLSAQYETLSDSDD XX SC translated from EMBL #U35312 XX FT 92 393 R1 (transcriptional repression) [25]. FT 392 1383 PF00478; IMP dehydrogenase / GMP reductase dom. FT 436 484 SM00717; sant. FT 437 482 PF00249; Myb-like DNA-binding domain. FT 619 669 PS50090; MYB_3. FT 623 671 SM00717; sant. FT 624 669 PF00249; Myb-like DNA-binding domain. FT 751 1016 R2 (transcriptional repression) [25]. FT 955 980 putative zinc-finger [26]. FT 1035 1460 R3 (transcriptional repression) [25]. FT 1944 2174 ID 1 (nuclear receptor interaction domain) [25]. FT 2238 2300 ID 2 (nuclear receptor interaction domain) [25]. FT 2277 2287 putative alpha-helix [26]. XX IN T09905 B-Myb; mouse, Mus musculus. IN T16699 B-Myb; Mammalia. IN T05687 CAR; mouse, Mus musculus. IN T08505 COUP-TF1; human, Homo sapiens. IN T09050 DEC1; rat, Rattus norvegicus. IN T08515 ER-beta; human, Homo sapiens. IN T16015 ER-beta; Mammalia. IN T21852 HDAC1; Mammalia. IN T04110 HDAC3; human, Homo sapiens. IN T08522 HDAC4-isoform1; human, Homo sapiens. IN T06042 HDAC4; human, Homo sapiens. IN T05252 HDAC5; human, Homo sapiens. IN T10857 LXR-alpha; mouse, Mus musculus. IN T25701 MTG8B; human, Homo sapiens. IN T08431 PPARalpha; mouse, Mus musculus. IN T08991 PPARalpha; rat, Rattus norvegicus. IN T09956 PPARalpha; Mammalia. IN T08432 PPARdelta; mouse, Mus musculus. IN T05332 PPARgamma2; mouse, Mus musculus. IN T08949 PXR; human, Homo sapiens. IN T01330 RAR-gamma1; human, Homo sapiens. IN T16103 RAR-gamma; Mammalia. IN T08348 RXR-alpha; mouse, Mus musculus. IN T09964 RXR-alpha; Mammalia. IN T14622 sin3a; human, Homo sapiens. IN T08326 Sp1; Mammalia. IN T00851 T3R-beta1; human, Homo sapiens. IN T15588 T3R-beta1; Mammalia. IN T08264 T3R-beta; human, Homo sapiens. IN T16580 T3R-beta; Mammalia. IN T08482 VDR-isoform1; human, Homo sapiens. XX DR TRANSPATH: MO000078829. DR EMBL: U35312; DR UniProtKB: Q60974-1; XX RN [1]; RE0016813. RX PUBMED: 10336495. RA Dowell P., Ishmael J. E., Avram D., Peterson V. J., Nevrivy D. J., Leid M. RT Identification of nuclear receptor corepressor as a peroxisome proliferator-activated receptor alpha interacting protein RL J. Biol. Chem. 274:15901-15907 (1999). RN [2]; RE0025706. RX PUBMED: 11903058. RA Krogsdam A. M., Nielsen C. A., Neve S., Holst D., Helledie T., Thomsen B., Bendixen C., Mandrup S., Kristiansen K. RT Nuclear receptor corepressor-dependent repression of peroxisome-proliferator-activated receptor delta-mediated transactivation. RL Biochem. J. 363:157-65 (2002). RN [3]; RE0027552. RX PUBMED: 10640275. RA Huang E. Y., Zhang J., Miska E. A., Guenther M. G., Kouzarides T., Lazar M. A. RT Nuclear receptor corepressors partner with class II histone deacetylases in a Sin3-independent repression pathway. RL Genes Dev. 14:45-54 (2000). RN [4]; RE0028062. RX PUBMED: 11279171. RA Elholm M., Dam I., Jorgensen C., Krogsdam A. M., Holst D., Kratchmarova I., Gottlicher M., Gustafsson J. A., Berge R., Flatmark T., Knudsen J., Mandrup S., Kristiansen K. RT Acyl-CoA esters antagonize the effects of ligands on peroxisome proliferator-activated receptor alpha conformation, DNA binding, and interaction with Co-factors. RL J. Biol. Chem. 276:21410-6 (2001). RN [5]; RE0029293. RX PUBMED: 11804585. RA Fischle W., Dequiedt F., Hendzel M. J., Guenther M. G., Lazar M. A., Voelter W., Verdin E. RT Enzymatic activity associated with class II HDACs is dependent on a multiprotein complex containing HDAC3 and SMRT/N-CoR. RL Mol. Cell 9:45-57 (2002). RN [6]; RE0034472. RX PUBMED: 10877839. RA Polly P., Herdick M., Moehren U., Baniahmad A., Heinzel T., Carlberg C. RT VDR-Alien: a novel, DNA-selective vitamin D(3) receptor-corepressor partnership. RL FASEB J. 14:1455-63 (2000). RN [7]; RE0036641. RX PUBMED: 12628926. RA Yoon H. G., Chan D. W., Huang Z. Q., Li J., Fondell J. D., Qin J., Wong J. RT Purification and functional characterization of the human N-CoR complex: the roles of HDAC3, TBL1 and TBLR1 RL EMBO J. 22:1336-1346 (2003). RN [8]; RE0037630. RX PUBMED: 12890497. RA Tai H. H., Geisterfer M., Bell J. C., Moniwa M., Davie J. R., Boucher L., McBurney M. W. RT CHD1 associates with NCoR and histone deacetylase as well as with RNA splicing proteins RL Biochem. Biophys. Res. Commun. 308:170-6 (2003). RN [9]; RE0042803. RX PUBMED: 14985122. RA Leong G. M., Subramaniam N., Issa L. L., Barry J. B., Kino T., Driggers P. H., Hayman M. J., Eisman J. A., Gardiner E. M. RT Ski-interacting protein, a bifunctional nuclear receptor coregulator that interacts with N-CoR/SMRT and p300 RL Biochem. Biophys. Res. Commun. 315:1070-6 (2004). RN [10]; RE0045619. RX PUBMED: 9405624. RA Zamir I., Dawson J., Lavinsky R. M., Glass C. K., Rosenfeld M. G., Lazar M. A. RT Cloning and characterization of a corepressor and potential component of the nuclear hormone receptor repression complex RL Proc. Natl. Acad. Sci. USA 94:14400-5 (1997). RN [11]; RE0046322. RX PUBMED: 11997503. RA Li X., McDonnell D. P. RT The transcription factor B-Myb is maintained in an inhibited state in target cells through its interaction with the nuclear corepressors N-CoR and SMRT RL Mol. Cell. Biol. 22:3663-73 (2002). RN [12]; RE0047306. RX PUBMED: 10737769. RA Sun H., Taneja R. RT Stra13 expression is associated with growth arrest and represses transcription through histone deacetylase (HDAC)-dependent and HDAC-independent mechanisms RL Proc. Natl. Acad. Sci. USA 97:4058-63 (2000). RN [13]; RE0047884. RX PUBMED: 14525983. RA Wu K., Yang Y., Wang C., Davoli M. A., D'Amico M., Li A., Cveklova K., Kozmik Z., Lisanti M. P., Russell R. G., Cvekl A., Pestell R. G. RT DACH1 inhibits transforming growth factor-beta signaling through binding Smad4. RL J. Biol. Chem. 278:51673-51684 (2003). RN [14]; RE0047937. RX PUBMED: 11331609. RA Shi Y., Downes M., Xie W., Kao H. Y., Ordentlich P., Tsai C. C., Hon M., Evans R. M. RT Sharp, an inducible cofactor that integrates nuclear receptor repression and activation. RL Genes Dev. 15:1140-1151 (2001). RN [15]; RE0048484. RX PUBMED: 10860984. RA Wen Y. D., Perissi V., Staszewski L. M., Yang W. M., Krones A., Glass C. K., Rosenfeld M. G., Seto E. RT The histone deacetylase-3 complex contains nuclear receptor corepressors. RL Proc. Natl. Acad. Sci. USA 97:7202-7207 (2000). RN [16]; RE0048612. RX PUBMED: 16024779. RA Zhang D., Yoon H. G., Wong J. RT JMJD2A is a novel N-CoR-interacting protein and is involved in repression of the human transcription factor achaete scute-like homologue 2 (ASCL2/Hash2). RL Mol. Cell. Biol. 25:6404-6414 (2005). RN [17]; RE0048852. RX PUBMED: 15377655. RA Lausen J., Cho S., Liu S., Werner M. H. RT The nuclear receptor co-repressor (N-CoR) utilizes repression domains I and III for interaction and co-repression with ETO. RL J. Biol. Chem. 279:49281-49288 (2004). RN [18]; RE0048863. RX PUBMED: 12904255. RA Webb P., Valentine C., Nguyen P., Price RH J. r., Marimuthu A., West B. L., Baxter J. D., Kushner P. J. RT ERbeta Binds N-CoR in the Presence of Estrogens via an LXXLL-like Motif in the N-CoR C-terminus. RL Nucl. Recept. 1:4 (2003). RN [19]; RE0048886. RX PUBMED: 11117528. RA Webb P., Anderson C. M., Valentine C., Nguyen P., Marimuthu A., West B. L., Baxter J. D., Kushner P. J. RT The nuclear receptor corepressor (N-CoR) contains three isoleucine motifs (I/LXXII) that serve as receptor interaction domains (IDs). RL Mol. Endocrinol. 14:1976-1985 (2000). RN [20]; RE0048913. RX PUBMED: 15878880. RA Lee J. A., Suh D. C., Kang J. E., Kim M. H., Park H., Lee M. N., Kim J. M., Jeon B. N., Roh H. E., Yu M. Y., Choi K. Y., Kim K. Y., Hur M. W. RT Transcriptional activity of Sp1 is regulated by molecular interactions between the zinc finger DNA binding domain and the inhibitory domain with corepressors, and this interaction is modulated by MEK. RL J. Biol. Chem. 280:28061-28071 (2005). RN [21]; RE0049111. RX PUBMED: 16421255. RA Tiefenbach J., Novac N., Ducasse M., Eck M., Melchior F., Heinzel T. RT SUMOylation of the corepressor N-CoR modulates its capacity to repress transcription. RL Mol. Biol. Cell 17:1643-1651 (2006). RN [22]; RE0051265. RX PUBMED: 17296605. RA Yamamoto T., Shimano H., Inoue N., Nakagawa Y., Matsuzaka T., Takahashi A., Yahagi N., Sone H., Suzuki H., Toyoshima H., Yamada N. RT Protein kinase A suppresses sterol regulatory element-binding protein-1C expression via phosphorylation of liver X receptor in the liver. RL J. Biol. Chem. 282:11687-11695 (2007). RN [23]; RE0066121. RX PUBMED: 15466465. RA Sandler B., Webb P., Apriletti J. W., Huber B. R., Togashi M., Cunha Lima S. T., Juric S., Nilsson S., Wagner R., Fletterick R. J., Baxter J. D. RT Thyroxine-thyroid hormone receptor interactions. RL J. Biol. Chem. 279:55801-55808 (2004). RN [24]; RE0074383. RX PUBMED: 19112178. RA Zhang L. J., Liu X., Gafken P. R., Kioussi C., Leid M. RT A chicken ovalbumin upstream promoter transcription factor I (COUP-TFI) complex represses expression of the gene encoding tumor necrosis factor alpha-induced protein 8 (TNFAIP8). RL J. Biol. Chem. 284:6156-6168 (2009). RN [25]; RE0016806. RX PUBMED: 11030619. RA Jepsen K., Hermanson O., Onami T. M., Gleiberman A. S., Lunyak V., McEvilly R. J., Kurokawa R., Kumar V., Liu F., Seto E., Hedrick S. M., Mandel G., Glass C. K., Rose D. W., Rosenfeld M. G. RT Combinatorial roles of the nuclear receptor corepressor in transcription and development RL Cell 102:753-763 (2000). RN [26]; RE0010819. RX PUBMED: 7566114. RA Hoerlein A. J., Naeaer A. M., Heinzel T., Torchia J., Gloss B., Kurokawa R., Ryan A., Kamei Y., Soederstroem M., Glass C. K., Rosenfeld M. G. RT Ligand-independent repression by the thyroid hormone receptor mediated by a nuclear receptor co-repressor RL Nature 377:397-404 (1995). XX //