TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T08991 XX ID T08991 XX DT 05.06.2006 (created); din. DT 31.05.2011 (updated); mka. CO Copyright (C), QIAGEN. XX FA PPARalpha XX SY NR1C1; peroxisome proliferator-activated receptor; peroxisome proliferator-activated receptor alpha; PPAR; PPARalpha. XX OS rat, Rattus norvegicus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G014219 Ppara. XX CL C0002; CC (rec). XX SZ 468 AA; 52.4 kDa (cDNA) (calc.). XX SQ MVDTESPICPLSPLEADDLESPLSEEFLQEMGNIQEISQSLGEESSGSFSFADYQYLGSC SQ PGSEGSVITDTLSPASSPSSVSCPAVPTSTDESPGNALNIECRICGDKASGYHYGVHACE SQ GCKGFFRRTIRLKLAYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSE SQ KAKLKAEILTCEHDLKDSETADLKSLAKRIHEAYLKNFNMNKVKARVILAGKTSNNPPFV SQ IHDMETLCMAEKTLVAKMVANGVENKEAEVRFFHCCQCMSVETVTELTEFAKAIPGFANL SQ DLNDQVTLLKYGVYEAIFTMLSSLMNKDGMLIAYGNGFITREFLKNLRKPFCDIMEPKFD SQ FAMKFNALELDDSDISLFVAAIICCGDRPGLLNIGYIEKLQEGIVHVLKLHLQSNHPDDT SQ FLFPKLLQKMVDLRQLVTEHAQLVQVIKKTESDAALHPLLQEIYRDMY XX SC translated from EMBL #M88592 XX FT 99 169 SM00399; c4gold. FT 99 173 PS51030; NUCLEAR_REC_DBD_2. FT 100 174 PF00105; Zinc finger, C4 type (two domains). FT 164 459 PF00478; IMP dehydrogenase / GMP reductase domai. FT 278 437 SM00430; holi. FT 281 463 PF00104; Ligand-binding domain of nuclear hormon. XX IN T25634 ASC-2; mouse, Mus musculus. IN T08434 CBP; rat, Rattus norvegicus. IN T08641 NCOR1-isoform1; mouse, Mus musculus. IN T09912 p300; rat, Rattus norvegicus. IN T01349 RXR-beta; rat, Rattus norvegicus. IN T04632 SRC-1; human, Homo sapiens. XX MX M00242 V$PPARA_01. MX M00518 V$PPARA_02. MX M01282 V$PPARA_Q6. MX M00763 V$PPARDR1_Q2. XX BS R03937. BS R03987. BS R03986. BS R34126. BS R35420. XX DR TRANSPATH: MO000082445. DR EMBL: M88592; DR UniProtKB: P37230; XX RN [1]; RE0002534. RX PUBMED: 1316614. RA Goettlicher M., Widmark E., Li Q., Gustafsson J. A. RT Fatty acids activate a chimera of the clofibric acid-activated receptor and the glucocorticoid receptor RL Proc. Natl. Acad. Sci. USA 89:4653-4657 (1992). RN [2]; RE0025706. RX PUBMED: 11903058. RA Krogsdam A. M., Nielsen C. A., Neve S., Holst D., Helledie T., Thomsen B., Bendixen C., Mandrup S., Kristiansen K. RT Nuclear receptor corepressor-dependent repression of peroxisome-proliferator-activated receptor delta-mediated transactivation. RL Biochem. J. 363:157-65 (2002). RN [3]; RE0030587. RX PUBMED: 12095700. RA Mochizuki K., Suruga K., Sakaguchi N., Takase S., Goda T. RT Major intestinal coactivator p300 strongly activates peroxisome proliferator-activated receptor in intestinal cell line, Caco-2. RL Gene 291:271-7 (2002). RN [4]; RE0032314. RX PUBMED: 12482853. RA Sumanasekera W. K., Tien E. S., Turpey R., Vanden Heuvel J. P., Perdew G. H. RT Evidence that peroxisome proliferator-activated receptor alpha is complexed with the 90-kDa heat shock protein and the hepatitis virus B X-associated protein 2. RL J. Biol. Chem. 278:4467-73 (2003). RN [5]; RE0039711. RX PUBMED: 15051727. RA Tien E. S., Davis J. W., Vanden Heuvel J. P. RT Identification of the CREB-binding protein/p300-interacting protein CITED2 as a peroxisome proliferator-activated receptor alpha coregulator RL J. Biol. Chem. 279:24053-63 (2004). RN [6]; RE0047822. RX PUBMED: 10903152. RA Hulkko S. M., Wakui H., Zilliacus J. RT The pro-apoptotic protein death-associated protein 3 (DAP3) interacts with the glucocorticoid receptor and affects the receptor function. RL Biochem. J. 349:885-893 (2000). RN [7]; RE0047960. RX PUBMED: 8910358. RA Chu R., Lin Y., Rao M. S., Reddy J. K. RT Cloning and identification of rat deoxyuridine triphosphatase as an inhibitor of peroxisome proliferator-activated receptor alpha. RL J. Biol. Chem. 271:27670-27676 (1996). RN [8]; RE0050597. RX PUBMED: 10681503. RA Caira F., Antonson P., Pelto-Huikko M., Treuter E., Gustafsson J. A. RT Cloning and characterization of RAP250, a novel nuclear receptor coactivator. RL J. Biol. Chem. 275:5308-5317 (2000). RN [9]; RE0050623. RX PUBMED: 9626662. RA Treuter E., Albrektsen T., Johansson L., Leers J., Gustafsson J. A. RT A regulatory role for RIP140 in nuclear receptor activation. RL Mol. Endocrinol. 12:864-881 (1998). RN [10]; RE0050969. RX PUBMED: 16280383. RA Gray J. P., Davis JW 2. n. d., Gopinathan L., Leas T. L., Nugent C. A., Vanden Heuvel J. P. RT The ribosomal protein rpL11 associates with and inhibits the transcriptional activity of peroxisome proliferator-activated receptor-alpha. RL Toxicol. Sci. 89:535-546 (2006). XX //