TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T08431 XX ID T08431 XX DT 19.01.2006 (created); din. DT 16.05.2012 (updated); pos. CO Copyright (C), QIAGEN. XX FA PPARalpha XX SY NR1C1; peroxisome proliferator-activated receptor; peroxisome proliferator-activated receptor alpha; PPAR; PPARalpha. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G004881 Ppara. XX CL C0002; CC (rec). XX SZ 468 AA; 52.4 kDa (cDNA) (calc.). XX SQ MVDTESPICPLSPLEADDLESPLSEEFLQEMGNIQEISQSIGEESSGSFGFADYQYLGSC SQ PGSEGSVITDTLSPRSSPSSVSCPVIPASTDESPGSALNIECRICGDKASGYHYGVHACE SQ GCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSE SQ KAKLKAEILTCEHDLKDSETADLKSLGKRIHEAYLKNFNMNKVKARVILAGKTSNNPPFV SQ IHDMETLCMAEKTLVAKMVANGVEDKEAEVRFFHCCQCMSVETVTELTEFAKAIPGFANL SQ DLNDQVTLLKYGVYEAIFTMLSSLMNKDGMLIAYGNGFITREFLKNLRKPFCDIMEPKFD SQ FAMKFNALELDDSDISLFVAAIICCGDRPGLLNIGYIEKLQEGIVHVLKLHLQSNHPDDT SQ FLFPKLLQKMVDLRQLVTEHAQLVQVIKKTESDAALHPLLQEIYRDMY XX SC tranlsated from EMBL #X57638 XX FT 47 459 PF00478; IMP dehydrogenase / GMP reductase domai. FT 99 169 SM00399; c4gold. FT 99 173 PS51030; NUCLEAR_REC_DBD_2. FT 100 174 PF00105; Zinc finger, C4 type (two domains). FT 101 166 DNA-binding domain [28]. FT 276 468 ligand-binding domain [28]. FT 278 437 SM00430; holi. FT 281 463 PF00104; Ligand-binding domain of nuclear hormon. XX FF specifically interacts with MEF-2C T01767, when activate human CCPT1BG018456 gene [16]; XX IN T25698 DRIP205-isoform4; mouse, Mus musculus. IN T08888 LXRalpha-isoform1; human, Homo sapiens. IN T08641 NCOR1-isoform1; mouse, Mus musculus. IN T04687 NCOR1; human, Homo sapiens. IN T01427 p300; human, Homo sapiens. IN T10542 p300; mouse, Mus musculus. IN T25677 p300; mouse, Mus musculus. IN T08348 RXR-alpha; mouse, Mus musculus. IN T08433 RXR-alpha; human, Homo sapiens. IN T04639 SRC-1; mouse, Mus musculus. IN T21552 SRC-1; Mammalia. IN T22422 SRC3-xbb2; human, Homo sapiens. XX MX M00242 V$PPARA_01. MX M00518 V$PPARA_02. MX M01282 V$PPARA_Q6. MX M00763 V$PPARDR1_Q2. XX BS R11591. BS R11592. BS R11593. BS R11594. BS R11595. BS R11596. BS R11597. BS R11598. BS R11604. BS R11605. BS R11606. BS R11607. BS R11608. BS R11609. BS R11610. BS R11611. BS R11612. BS R11613. BS R11614. BS R11615. BS R11616. BS R11617. BS R11618. BS R11619. BS R11621. BS R11622. BS R18613. BS R27488. BS R27483. BS R13164. BS R12750. BS R19277. BS R20242. XX DR TRANSPATH: MO000057686. DR EMBL: X57638; DR UniProtKB: P23204; XX RN [1]; RE0011203. RX PUBMED: 8521497. RA Forman B.M., Tontonoz P., Chen J., Brun R. P., Spiegelman B. M., Evans R. M. RT 15-Deoxy-delta12,14-prostaglandin J2 is a ligand for the adipocyte determination factor PPARgamma RL Cell 83:803-812 (1995). RN [2]; RE0011205. RX PUBMED: 8521498. RA Kliewer S. A., Lenhard J. M., Willson T. M., Patel I., Morris D. C., Lehmann J. M. RT A prostaglandin J2 metabolite binds peroxisome proliferator-activated receptor gamma and promotes adipocyte differentiation RL Cell 83:813-819 (1995). RN [3]; RE0016043. RX PUBMED: 8621574. RA Miyata K. S., McCaw S. E., Patel H. V., Rachubinski R. A., Capone J. P. RT The orphan nuclear hormone receptor LXR alpha interacts with the peroxisome proliferator-activated receptor and inhibits peroxisome proliferator signaling RL J. Biol. Chem. 271:9189-9192 (1996). RN [4]; RE0016813. RX PUBMED: 10336495. RA Dowell P., Ishmael J. E., Avram D., Peterson V. J., Nevrivy D. J., Leid M. RT Identification of nuclear receptor corepressor as a peroxisome proliferator-activated receptor alpha interacting protein RL J. Biol. Chem. 274:15901-15907 (1999). RN [5]; RE0018154. RX PUBMED: 11577087. RA Barger P. M., Browning A. C., Garner A. N., Kelly D. P. RT p38 mitogen-activated protein kinase activates peroxisome proliferator-activated receptor alpha: a potential role in the cardiac metabolic stress response. RL J. Biol. Chem. 276:44495-44501 (2001). RN [6]; RE0025706. RX PUBMED: 11903058. RA Krogsdam A. M., Nielsen C. A., Neve S., Holst D., Helledie T., Thomsen B., Bendixen C., Mandrup S., Kristiansen K. RT Nuclear receptor corepressor-dependent repression of peroxisome-proliferator-activated receptor delta-mediated transactivation. RL Biochem. J. 363:157-65 (2002). RN [7]; RE0026435. RX PUBMED: 10788465. RA Zhu Y., Kan L., Qi C., Kanwar Y. S., Yeldandi A. V., Rao M. S., Reddy J. K. RT Isolation and characterization of peroxisome proliferator-activated receptor (PPAR) interacting protein (PRIP) as a coactivator for PPAR. RL J. Biol. Chem. 275:13510-6 (2000). RN [8]; RE0028062. RX PUBMED: 11279171. RA Elholm M., Dam I., Jorgensen C., Krogsdam A. M., Holst D., Kratchmarova I., Gottlicher M., Gustafsson J. A., Berge R., Flatmark T., Knudsen J., Mandrup S., Kristiansen K. RT Acyl-CoA esters antagonize the effects of ligands on peroxisome proliferator-activated receptor alpha conformation, DNA binding, and interaction with Co-factors. RL J. Biol. Chem. 276:21410-6 (2001). RN [9]; RE0037964. RX PUBMED: 9795230. RA Masuda N., Yasumo H., Furusawa T., Tsukamoto T., Sadano H., Osumi T. RT Nuclear receptor binding factor-1 (NRBF-1), a protein interacting with a wide spectrum of nuclear hormone receptors RL Gene 221:225-33 (1998). RN [10]; RE0038430. RX PUBMED: 12955147. RA Fu J., Gaetani S., Oveisi F., Lo Verme J., Serrano A., Rodriguez de Fonseca F., Rosengarth A., Luecke H., Di Giacomo B., Tarzia G., Piomelli D. RT Oleylethanolamide regulates feeding and body weight through activation of the nuclear receptor PPAR-alpha RL Nature 425:90-3 (2003). RN [11]; RE0039064. RX PUBMED: 10022764. RA Miyata K. S., McCaw S. E., Meertens L. M., Patel H. V., Rachubinski R. A., Capone J. P. RT Receptor-interacting protein 140 interacts with and inhibits transactivation by, peroxisome proliferator-activated receptor alpha and liver-X-receptor alpha RL Mol. Cell. Endocrinol. 146:69-76 (1998). RN [12]; RE0040618. RX PUBMED: 9325263. RA Zhu Y., Qi C., Jain S., Rao M. S., Reddy J. K. RT Isolation and characterization of PBP, a protein that interacts with peroxisome proliferator-activated receptor RL J. Biol. Chem. 272:25500-6 (1997). RN [13]; RE0040875. RX PUBMED: 9407140. RA Dowell P., Ishmael J. E., Avram D., Peterson V. J., Nevrivy D. J., Leid M. RT p300 functions as a coactivator for the peroxisome proliferator-activated receptor alpha RL J. Biol. Chem. 272:33435-43 (1997). RN [14]; RE0040896. RX PUBMED: 11226238. RA Wolfrum C., Borrmann C. M., Borchers T., Spener F. RT Fatty acids and hypolipidemic drugs regulate peroxisome proliferator-activated receptors alpha - and gamma -mediated gene expression via liver fatty acid binding protein: A signaling path to the nucleus RL Proc. Natl. Acad. Sci. USA 98:2323-2328 (2001). RN [15]; RE0040918. RX PUBMED: 9556573. RA Yan Z. H., Karam W. G., Staudinger J. L., Medvedev A., Ghanayem B. I., Jetten A. M. RT Regulation of peroxisome proliferator-activated receptor alpha-induced transactivation by the nuclear orphan receptor TAK1/TR4 RL J. Biol. Chem. 273:10948-57 (1998). RN [16]; RE0044082. RX PUBMED: 15356291. RA Baldan A., Relat J., Marrero P. F., Haro D. RT Functional interaction between peroxisome proliferator-activated receptors-alpha and Mef-2C on human carnitine palmitoyltransferase 1beta (CPT1beta) gene activation RL Nucleic Acids Res. 32:4742-9 (2004). RN [17]; RE0047832. RX PUBMED: 15615782. RA Patel H., Truant R., Rachubinski R. A., Capone J. P. RT Activity and subcellular compartmentalization of peroxisome proliferator-activated receptor alpha are altered by the centrosome-associated protein CAP350. RL J. Cell Sci. 118:175-186 (2005). RN [18]; RE0047960. RX PUBMED: 8910358. RA Chu R., Lin Y., Rao M. S., Reddy J. K. RT Cloning and identification of rat deoxyuridine triphosphatase as an inhibitor of peroxisome proliferator-activated receptor alpha. RL J. Biol. Chem. 271:27670-27676 (1996). RN [19]; RE0049238. RX PUBMED: 16534556. RA Shimizu M., Yamashita D., Yamaguchi T., Hirose F., Osumi T. RT Aspects of the regulatory mechanisms of PPAR functions: analysis of a bidirectional response element and regulation by sumoylation. RL Mol. Cell. Biochem. 286:33-42 (2006). RN [20]; RE0050076. RX PUBMED: 15774422. RA Hostetler H. A., Petrescu A. D., Kier A. B., Schroeder F. RT Peroxisome proliferator-activated receptor alpha interacts with high affinity and is conformationally responsive to endogenous ligands. RL J. Biol. Chem. 280:18667-18682 (2005). RN [21]; RE0050147. RX PUBMED: 12124379. RA Cowart L. A., Wei S., Hsu M. H., Johnson E. F., Krishna M. U., Falck J. R., Capdevila J. H. RT The CYP4A isoforms hydroxylate epoxyeicosatrienoic acids to form high affinity peroxisome proliferator-activated receptor ligands. RL J. Biol. Chem. 277:35105-35112 (2002). RN [22]; RE0050167. RX PUBMED: 16113065. RA Fang X., Hu S., Xu B., Snyder G. D., Harmon S., Yao J., Liu Y., Sangras B., Falck J. R., Weintraub N. L., Spector A. A. RT 14,15-Dihydroxyeicosatrienoic acid activates peroxisome proliferator-activated receptor-alpha. RL Am. J. Physiol. Heart Circ. Physiol. 290:H55-63 (2006). RN [23]; RE0050188. RX PUBMED: 17164145. RA Fang X., Dillon J. S., Hu S., Harmon S. D., Yao J., Anjaiah S., Falck J. R., Spector A. A. RT 20-carboxy-arachidonic acid is a dual activator of peroxisome proliferator-activated receptors alpha and gamma. RL Prostaglandins Other Lipid Mediat. 82:175-184 (2007). RN [24]; RE0050281. RX PUBMED: 10989283. RA Van Veldhoven P. P., Mannaerts G. P., Declercq P., Baes M. RT Do sphingoid bases interact with the peroxisome proliferator activated receptor alpha (PPAR-alpha)? RL Cell. Signal. 12:475-479 (2000). RN [25]; RE0050313. RX PUBMED: 10428978. RA Moya-Camarena S. Y., Vanden Heuvel J. P., Blanchard S. G., Leesnitzer L. A., Belury M. A. RT Conjugated linoleic acid is a potent naturally occurring ligand and activator of PPARalpha. RL J. Lipid Res. 40:1426-1433 (1999). RN [26]; RE0050322. RX PUBMED: 16768463. RA Hostetler H. A., Kier A. B., Schroeder F. RT Very-long-chain and branched-chain fatty acyl-CoAs are high affinity ligands for the peroxisome proliferator-activated receptor alpha (PPARalpha). RL Biochemistry 45:7669-7681 (2006). RN [27]; RE0050812. RX PUBMED: 15312046. RA Bronner M., Hertz R., Bar-Tana J. RT Kinase-independent transcriptional co-activation of peroxisome proliferator-activated receptor alpha by AMP-activated protein kinase. RL Biochem. J. 384:295-305 (2004). RN [28]; RE0018281. RX PUBMED: 8041794. RA Kliewer S. A., Forman B. M., Blumberg B., Ong E. S., Borgmeyer U., Mangelsdorf D. J., Umesono K., Evans R. M. RT Differential expression and activation of a family of murine peroxisome proliferator-activated receptors. RL Proc. Natl. Acad. Sci. USA 91:7355-7359 (1994). XX //