TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T08888 XX ID T08888 XX DT 05.05.2006 (created); jag. DT 10.11.2014 (updated); spk. CO Copyright (C), QIAGEN. XX FA LXRalpha-isoform1 XX SY liver X receptor alpha; LXR; LXR A; LXR-A; LXRA; NR1H3; nuclear orphan receptor LXR-alpha. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G004013 NR1H3; HGNC: NR1H3. XX CL C0002; CC (rec); 2.1.2.7.1.1. XX SZ 447 AA; 50.5 kDa (cDNA) (calc.). XX SQ MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEA SQ AEPTALLTRAEPPSEPTEIRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKG SQ FFRRSVIKGAHYICHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLK SQ RQEEEQAHATSLPPRRSSPPQILPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPM SQ APDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLL SQ ETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLI SQ AISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSV SQ HSEQVFALRLQDKKLPPLLSEIWDVHE XX SC translated from EMBL:U22662 XX FT 95 166 SM00399; c4gold. FT 95 170 PS51030; NUCLEAR_REC_DBD_2. FT 96 171 PF00105; Zinc finger, C4 type (two domains). FT 259 418 SM00430; holi. FT 262 442 PF00104; Ligand-binding domain of nuclear hormon. XX IN T08796 ASC-2; human, Homo sapiens. IN T04687 NCOR1; human, Homo sapiens. IN T08431 PPARalpha; mouse, Mus musculus. IN T08433 RXR-alpha; human, Homo sapiens. IN T09964 RXR-alpha; Mammalia. IN T16715 RXR-gamma; mouse, Mus musculus. IN T04689 SMRT; human, Homo sapiens. IN T04632 SRC-1; human, Homo sapiens. XX MX M00965 V$DR4_Q2. MX M00647 V$LXR_Q3. MX M03795 V$LXR_Q6. MX M07280 V$NR1NR2_Q3. XX DR TRANSPATH: MO000081004. DR EMBL: U22662; DR UniProtKB: Q13133-1; XX RN [1]; RE0016043. RX PUBMED: 8621574. RA Miyata K. S., McCaw S. E., Patel H. V., Rachubinski R. A., Capone J. P. RT The orphan nuclear hormone receptor LXR alpha interacts with the peroxisome proliferator-activated receptor and inhibits peroxisome proliferator signaling RL J. Biol. Chem. 271:9189-9192 (1996). RN [2]; RE0016108. RX PUBMED: 9013544. RA Lehmann J. M., Kliewer S. A., Moore L. B., Smith-Oliver T. A., Oliver B. B., Su J. L., Sundseth S. S., Winegar D. A., Blanchard D. E., Spencer T. A., Willson T. M. RT Activation of the nuclear receptor LXR by oxysterols defines a new hormone response pathway RL J. Biol. Chem. 272:3137-3140 (1997). RN [3]; RE0047682. RX PUBMED: 12040021. RA Brendel C., Gelman L., Auwerx J. RT Multiprotein bridging factor-1 (MBF-1) is a cofactor for nuclear receptors that regulate lipid metabolism. RL Mol. Endocrinol. 16:1367-1377 (2002). RN [4]; RE0048796. RX PUBMED: 12897148. RA Wagner B. L., Valledor A. F., Shao G., Daige C. L., Bischoff E. D., Petrowski M., Jepsen K., Baek S. H., Heyman R. A., Rosenfeld M. G., Schulman I. G., Glass C. K. RT Promoter-specific roles for liver X receptor/corepressor complexes in the regulation of ABCA1 and SREBP1 gene expression. RL Mol. Cell. Biol. 23:5780-5789 (2003). RN [5]; RE0051006. RX PUBMED: 9380679. RA Forman B. M., Ruan B., Chen J., Schroepfer GJ J. r., Evans R. M. RT The orphan nuclear receptor LXRalpha is positively and negatively regulated by distinct products of mevalonate metabolism. RL Proc. Natl. Acad. Sci. USA 94:10588-10593 (1997). RN [6]; RE0051017. RX PUBMED: 16857673. RA Yang C., McDonald J. G., Patel A., Zhang Y., Umetani M., Xu F., Westover E. J., Covey D. F., Mangelsdorf D. J., Cohen J. C., Hobbs H. H. RT Sterol intermediates from cholesterol biosynthetic pathway as liver X receptor ligands. RL J. Biol. Chem. 281:27816-27826 (2006). RN [7]; RE0051058. RX PUBMED: 16415294. RA Schmidt R. J., Ficorilli J. V., Zhang Y., Bramlett K. S., Beyer T. P., Borchert K., Dowless M. S., Houck K. A., Burris T. P., Eacho P. I., Liang G., Guo L. W., Wilson W. K., Michael L. F., Cao G. RT A 15-ketosterol is a liver X receptor ligand that suppresses sterol-responsive element binding protein-2 activity. RL J. Lipid Res. 47:1037-1044 (2006). RN [8]; RE0051059. RX PUBMED: 11089551. RA Song C., Liao S. RT Cholestenoic acid is a naturally occurring ligand for liver X receptor alpha. RL Endocrinology 141:4180-4184 (2000). RN [9]; RE0051160. RX PUBMED: 12847102. RA Kaneko E., Matsuda M., Yamada Y., Tachibana Y., Shimomura I., Makishima M. RT Induction of intestinal ATP-binding cassette transporters by a phytosterol-derived liver X receptor agonist. RL J. Biol. Chem. 278:36091-36098 (2003). RN [10]; RE0051446. RX PUBMED: 17391100. RA Jakobsson T., Osman W., Gustafsson J. A., Zilliacus J., Warnmark A. RT Molecular basis for repression of liver X receptor-mediated gene transcription by receptor-interacting protein 140. RL Biochem. J. 405:31-39 (2007). XX //