
AC   T01767
XX
ID   T01767
XX
DT   18.04.1996 (created); ewi.
DT   22.11.2006 (updated); kar.
CO   Copyright (C), QIAGEN.
XX
FA   MEF-2C
XX
SY   MADS box transcription enhancer factor 2, polypeptide C (myocyte enhancer factor 2C); MEF-2C (473 AA form); MEF2C.
XX
OS   human, Homo sapiens
OC   eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE   G003969 MEF2C; HGNC: MEF2C.
XX
CL   C0014; MADS; 5.1.1.1.3.1.
XX
SZ   473 AA; 51.2 kDa (cDNA) (calc.).
XX
SQ   MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYAST
SQ   DMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCDSPDPDADDSVGHSPESEDKYRKI
SQ   NEDIDLMISRQRLCAVPPPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRN
SQ   SMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKS
SQ   PPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDVDLLLNQRINNSQSAQSLATPVVSVAT
SQ   PTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGWQQQHLHNMPP
SQ   SALSQLGACTSTHLSQSSNLSLPSTQSLNIKSEPVSPPRDRTTTPSRYPQHTRHEAGRSP
SQ   VDSLSSCSSSYDGSDREDHRNEFHSPIGLTRPSPDERESPSVKRMRLSEGWAT
XX
SC   conceptually translated from EMBL/GenBank #L08895
XX
FT        1     60    SM00432; MADS.
FT        1     61
   SM00432; MADS.
FT        1     61    PS50066; MADS_BOX_2.
FT        9     59
   PS50066; MADS_BOX_2.
FT        9     59    PF00319; SRF-type transcription factor (DNA-binding a.
   PF00319; SRF-type transcription factor (DNA-binding a.
 XX
SF   alternative splice variants are MEF-2C (465 AA form), MEF-2C/delta32 and MEF-2C (433 AA form) [1] [2];
SF   phosphorylation increases binding activity [5];
SF   phosphorylation sites: T293, T300 and S387 [5];
SF   MEF-2C binds as dimer to MEF-site [7];
SF   basic residues K23 and R24 play important roles in DNA binding [3];
XX
CP   (embryo, adult:) high levels in skeletal muscle, lower in brain (cerebral cortex) [1].
CN   adrenal, heart, kidney, liver, lung, placenta, small intestine, spleen, thymus [1] [2].
XX
FF   specifically interacts with PPAR-alpha T08431, when activate human CCPT1BG018456 gene [10];
FF   transcriptional activator [1];
FF   in adult mice, exon A-containing MEF-2C variants (473 and 441 AA forms) have been found in the brain only using human sequence information [2];
FF   expression throughout cortical plate in 14 week human fetal cerebral cortex, in 16 to 27 week human fetal cortical plate a bilaminate distribution, in 29 week fetal cortical plate to newborn until adult neocortex a trilaminate expression pattern [4];
FF   activated by MAP kinase p38 in inflammation [5];
XX
MX   M02025 V$MEF2C_Q4.
MX   M00941 V$MEF2_Q6_01.
MX   M07424 V$MEF2_Q6_03.
XX
BS   R19628.
BS   R19234.
XX
DR   TRANSPATH: MO000025908.
DR   EMBL: L08895;
DR   UniProtKB: Q06413-1;
XX
RN   [1]; RE0004080.
RX   PUBMED: 7679508.
RA   Leifer D., Krainc D., Yu Y.-T., McDermott J., Breitbart R. E., Heng J., Neve R. L., Kosofsky B., Nadal-Ginard B., Lipton S. A.
RT   MEF2C, a MADS/MEF2-family transcription factor expressed in a laminar distribution in cerebral cortex
RL   Proc. Natl. Acad. Sci. USA 90:1546-1550 (1993).
RN   [2]; RE0006947.
RX   PUBMED: 8455629.
RA   McDermott J. C., Cardoso M. C., Yu Y.-T., Andres V., Leifer D., Krainc D., Lipton S. A., Nadal-Ginard B.
RT   hMEF2C gene encodes skeletal muscle- and brain-specific transcription factors
RL   Mol. Cell. Biol. 13:2564-2577 (1993).
RN   [3]; RE0006948.
RX   PUBMED: 8649370.
RA   Molkentin J. D., Black B. L., Martin J. F., Olson E. N.
RT   Mutational analysis of the DNA binding, dimerization and transcriptional activation domains of MEF2C
RL   Mol. Cell. Biol. 16:2627-2636 (1996).
RN   [4]; RE0014915.
RX   PUBMED: 7700509.
RA   Leifer D., Golden J., Kowall N.W.
RT   Myocyte-specific enhancer binding factor 2C expression in human brain development
RL   Neuroscience 63:1067-79 (1994).
RN   [5]; RE0015230.
RX   PUBMED: 9069290.
RA   Han J., Jiang Y., Li Z., Kravchenko V. V., Ulevitch R. J.
RT   Activation of the transcription factor MEF2C by the MAP kinase p38 in inflammation
RL   Nature 386:296-299 (1997).
RN   [6]; RE0015262.
RX   PUBMED: 9748284.
RA   Meierhans D., Allemann R. K.
RT   The N-terminal methionine is a major determinant of the DNA binding specificity of MEF-2C
RL   J. Biol. Chem. 273:26052-26060 (1998).
RN   [7]; RE0015268.
RX   PUBMED: 9425635.
RA   Meierhans D., Allemann R. K.
RT   High level expression in soluble form, one step purification, and characterization of the DNA binding domain of MEF-2C
RL   Protein Expression and Purification 11:297-303 (1997).
RN   [8]; RE0030417.
RX   PUBMED: 14592977.
RA   Cheung P. C., Campbell D. G., Nebreda A. R., Cohen P.
RT   Feedback control of the protein kinase TAK1 by SAPK2a/p38alpha.
RL   EMBO J. 22:5793-805 (2003).
RN   [9]; RE0035630.
RX   PUBMED: 15831463.
RA   Ma K., Chan J. K., Zhu G., Wu Z.
RT   Myocyte enhancer factor 2 acetylation by p300 enhances its DNA binding activity, transcriptional activity, and myogenic differentiation.
RL   Mol. Cell. Biol. 25:3575-3582 (2005).
RN   [10]; RE0044082.
RX   PUBMED: 15356291.
RA   Baldan A., Relat J., Marrero P. F., Haro D.
RT   Functional interaction between peroxisome proliferator-activated receptors-alpha and Mef-2C on human carnitine palmitoyltransferase 1beta (CPT1beta) gene activation
RL   Nucleic Acids Res. 32:4742-9 (2004).
XX
//
XX
SF   alternative splice variants are MEF-2C (465 AA form), MEF-2C/delta32 and MEF-2C (433 AA form) [1] [2];
SF   phosphorylation increases binding activity [5];
SF   phosphorylation sites: T293, T300 and S387 [5];
SF   MEF-2C binds as dimer to MEF-site [7];
SF   basic residues K23 and R24 play important roles in DNA binding [3];
XX
CP   (embryo, adult:) high levels in skeletal muscle, lower in brain (cerebral cortex) [1].
CN   adrenal, heart, kidney, liver, lung, placenta, small intestine, spleen, thymus [1] [2].
XX
FF   specifically interacts with PPAR-alpha T08431, when activate human CCPT1BG018456 gene [10];
FF   transcriptional activator [1];
FF   in adult mice, exon A-containing MEF-2C variants (473 and 441 AA forms) have been found in the brain only using human sequence information [2];
FF   expression throughout cortical plate in 14 week human fetal cerebral cortex, in 16 to 27 week human fetal cortical plate a bilaminate distribution, in 29 week fetal cortical plate to newborn until adult neocortex a trilaminate expression pattern [4];
FF   activated by MAP kinase p38 in inflammation [5];
XX
MX   M02025 V$MEF2C_Q4.
MX   M00941 V$MEF2_Q6_01.
MX   M07424 V$MEF2_Q6_03.
XX
BS   R19628.
BS   R19234.
XX
DR   TRANSPATH: MO000025908.
DR   EMBL: L08895;
DR   UniProtKB: Q06413-1;
XX
RN   [1]; RE0004080.
RX   PUBMED: 7679508.
RA   Leifer D., Krainc D., Yu Y.-T., McDermott J., Breitbart R. E., Heng J., Neve R. L., Kosofsky B., Nadal-Ginard B., Lipton S. A.
RT   MEF2C, a MADS/MEF2-family transcription factor expressed in a laminar distribution in cerebral cortex
RL   Proc. Natl. Acad. Sci. USA 90:1546-1550 (1993).
RN   [2]; RE0006947.
RX   PUBMED: 8455629.
RA   McDermott J. C., Cardoso M. C., Yu Y.-T., Andres V., Leifer D., Krainc D., Lipton S. A., Nadal-Ginard B.
RT   hMEF2C gene encodes skeletal muscle- and brain-specific transcription factors
RL   Mol. Cell. Biol. 13:2564-2577 (1993).
RN   [3]; RE0006948.
RX   PUBMED: 8649370.
RA   Molkentin J. D., Black B. L., Martin J. F., Olson E. N.
RT   Mutational analysis of the DNA binding, dimerization and transcriptional activation domains of MEF2C
RL   Mol. Cell. Biol. 16:2627-2636 (1996).
RN   [4]; RE0014915.
RX   PUBMED: 7700509.
RA   Leifer D., Golden J., Kowall N.W.
RT   Myocyte-specific enhancer binding factor 2C expression in human brain development
RL   Neuroscience 63:1067-79 (1994).
RN   [5]; RE0015230.
RX   PUBMED: 9069290.
RA   Han J., Jiang Y., Li Z., Kravchenko V. V., Ulevitch R. J.
RT   Activation of the transcription factor MEF2C by the MAP kinase p38 in inflammation
RL   Nature 386:296-299 (1997).
RN   [6]; RE0015262.
RX   PUBMED: 9748284.
RA   Meierhans D., Allemann R. K.
RT   The N-terminal methionine is a major determinant of the DNA binding specificity of MEF-2C
RL   J. Biol. Chem. 273:26052-26060 (1998).
RN   [7]; RE0015268.
RX   PUBMED: 9425635.
RA   Meierhans D., Allemann R. K.
RT   High level expression in soluble form, one step purification, and characterization of the DNA binding domain of MEF-2C
RL   Protein Expression and Purification 11:297-303 (1997).
RN   [8]; RE0030417.
RX   PUBMED: 14592977.
RA   Cheung P. C., Campbell D. G., Nebreda A. R., Cohen P.
RT   Feedback control of the protein kinase TAK1 by SAPK2a/p38alpha.
RL   EMBO J. 22:5793-805 (2003).
RN   [9]; RE0035630.
RX   PUBMED: 15831463.
RA   Ma K., Chan J. K., Zhu G., Wu Z.
RT   Myocyte enhancer factor 2 acetylation by p300 enhances its DNA binding activity, transcriptional activity, and myogenic differentiation.
RL   Mol. Cell. Biol. 25:3575-3582 (2005).
RN   [10]; RE0044082.
RX   PUBMED: 15356291.
RA   Baldan A., Relat J., Marrero P. F., Haro D.
RT   Functional interaction between peroxisome proliferator-activated receptors-alpha and Mef-2C on human carnitine palmitoyltransferase 1beta (CPT1beta) gene activation
RL   Nucleic Acids Res. 32:4742-9 (2004).
XX
//