TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01767 XX ID T01767 XX DT 18.04.1996 (created); ewi. DT 22.11.2006 (updated); kar. CO Copyright (C), QIAGEN. XX FA MEF-2C XX SY MADS box transcription enhancer factor 2, polypeptide C (myocyte enhancer factor 2C); MEF-2C (473 AA form); MEF2C. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G003969 MEF2C; HGNC: MEF2C. XX CL C0014; MADS; 5.1.1.1.3.1. XX SZ 473 AA; 51.2 kDa (cDNA) (calc.). XX SQ MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYAST SQ DMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCDSPDPDADDSVGHSPESEDKYRKI SQ NEDIDLMISRQRLCAVPPPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRN SQ SMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKS SQ PPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDVDLLLNQRINNSQSAQSLATPVVSVAT SQ PTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGWQQQHLHNMPP SQ SALSQLGACTSTHLSQSSNLSLPSTQSLNIKSEPVSPPRDRTTTPSRYPQHTRHEAGRSP SQ VDSLSSCSSSYDGSDREDHRNEFHSPIGLTRPSPDERESPSVKRMRLSEGWAT XX SC conceptually translated from EMBL/GenBank #L08895 XX FT 1 60 SM00432; MADS. FT 1 61 PS50066; MADS_BOX_2. FT 9 59 PF00319; SRF-type transcription factor (DNA-binding a. XX SF alternative splice variants are MEF-2C (465 AA form), MEF-2C/delta32 and MEF-2C (433 AA form) [1] [2]; SF phosphorylation increases binding activity [5]; SF phosphorylation sites: T293, T300 and S387 [5]; SF MEF-2C binds as dimer to MEF-site [7]; SF basic residues K23 and R24 play important roles in DNA binding [3]; XX CP (embryo, adult:) high levels in skeletal muscle, lower in brain (cerebral cortex) [1]. CN adrenal, heart, kidney, liver, lung, placenta, small intestine, spleen, thymus [1] [2]. XX FF specifically interacts with PPAR-alpha T08431, when activate human CCPT1BG018456 gene [10]; FF transcriptional activator [1]; FF in adult mice, exon A-containing MEF-2C variants (473 and 441 AA forms) have been found in the brain only using human sequence information [2]; FF expression throughout cortical plate in 14 week human fetal cerebral cortex, in 16 to 27 week human fetal cortical plate a bilaminate distribution, in 29 week fetal cortical plate to newborn until adult neocortex a trilaminate expression pattern [4]; FF activated by MAP kinase p38 in inflammation [5]; XX MX M02025 V$MEF2C_Q4. MX M00941 V$MEF2_Q6_01. MX M07424 V$MEF2_Q6_03. XX BS R19628. BS R19234. XX DR TRANSPATH: MO000025908. DR EMBL: L08895; DR UniProtKB: Q06413-1; XX RN [1]; RE0004080. RX PUBMED: 7679508. RA Leifer D., Krainc D., Yu Y.-T., McDermott J., Breitbart R. E., Heng J., Neve R. L., Kosofsky B., Nadal-Ginard B., Lipton S. A. RT MEF2C, a MADS/MEF2-family transcription factor expressed in a laminar distribution in cerebral cortex RL Proc. Natl. Acad. Sci. USA 90:1546-1550 (1993). RN [2]; RE0006947. RX PUBMED: 8455629. RA McDermott J. C., Cardoso M. C., Yu Y.-T., Andres V., Leifer D., Krainc D., Lipton S. A., Nadal-Ginard B. RT hMEF2C gene encodes skeletal muscle- and brain-specific transcription factors RL Mol. Cell. Biol. 13:2564-2577 (1993). RN [3]; RE0006948. RX PUBMED: 8649370. RA Molkentin J. D., Black B. L., Martin J. F., Olson E. N. RT Mutational analysis of the DNA binding, dimerization and transcriptional activation domains of MEF2C RL Mol. Cell. Biol. 16:2627-2636 (1996). RN [4]; RE0014915. RX PUBMED: 7700509. RA Leifer D., Golden J., Kowall N.W. RT Myocyte-specific enhancer binding factor 2C expression in human brain development RL Neuroscience 63:1067-79 (1994). RN [5]; RE0015230. RX PUBMED: 9069290. RA Han J., Jiang Y., Li Z., Kravchenko V. V., Ulevitch R. J. RT Activation of the transcription factor MEF2C by the MAP kinase p38 in inflammation RL Nature 386:296-299 (1997). RN [6]; RE0015262. RX PUBMED: 9748284. RA Meierhans D., Allemann R. K. RT The N-terminal methionine is a major determinant of the DNA binding specificity of MEF-2C RL J. Biol. Chem. 273:26052-26060 (1998). RN [7]; RE0015268. RX PUBMED: 9425635. RA Meierhans D., Allemann R. K. RT High level expression in soluble form, one step purification, and characterization of the DNA binding domain of MEF-2C RL Protein Expression and Purification 11:297-303 (1997). RN [8]; RE0030417. RX PUBMED: 14592977. RA Cheung P. C., Campbell D. G., Nebreda A. R., Cohen P. RT Feedback control of the protein kinase TAK1 by SAPK2a/p38alpha. RL EMBO J. 22:5793-805 (2003). RN [9]; RE0035630. RX PUBMED: 15831463. RA Ma K., Chan J. K., Zhu G., Wu Z. RT Myocyte enhancer factor 2 acetylation by p300 enhances its DNA binding activity, transcriptional activity, and myogenic differentiation. RL Mol. Cell. Biol. 25:3575-3582 (2005). RN [10]; RE0044082. RX PUBMED: 15356291. RA Baldan A., Relat J., Marrero P. F., Haro D. RT Functional interaction between peroxisome proliferator-activated receptors-alpha and Mef-2C on human carnitine palmitoyltransferase 1beta (CPT1beta) gene activation RL Nucleic Acids Res. 32:4742-9 (2004). XX //