AC T05332
XX
ID T05332
XX
DT 01.11.2002 (created); oke.
DT 24.12.2014 (updated); pro.
CO Copyright (C), QIAGEN.
XX
FA PPARgamma2
XX
SY NR1C3; peroxisome proliferator activated receptor gamma; PPAR-gamma; PPARG.
XX
OS mouse, Mus musculus
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae
XX
GE G004880 Pparg.
XX
CL C0002; CC (rec); 2.1.2.5.3.2.
XX
SZ 505 AA; 57.6 kDa (cDNA) (calc.).
XX
SQ MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGISSVDLSVMEDHSHSF
SQ DIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKT
SQ QLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNC
SQ RIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLR
SQ ALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQE
SQ QSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLAS
SQ LMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII
SQ LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQL
SQ LHVIKKTETDMSLHPLLQEIYKDLY
XX
SC translated from EMBL #BC021798
XX
FT 1 380 
PF00478; IMP dehydrogenase / GMP reductase domai.
FT 110 113 
consensus MAP kinase site [5].
FT 136 206 
SM00399; c4gold.
FT 136 210 
PS51030; NUCLEAR_REC_DBD_2.
FT 137 211 
PF00105; Zinc finger, C4 type (two domains).
FT 315 474 
SM00430; holi.
FT 318 500 
PF00104; Ligand-binding domain of nuclear hormon.
XX
SF one of two known isoforms produced from the alternative promoter and by alternative splicing [2];
SF for other splice variants, see mouse PPAR-gamma T05347 and mouse PPAR-gamma1 T02529;
SF forms heterodimers with RXR-alpha [1];
XX
FF activator as heterodimer with RXR-alpha [1];
FF one of the key regulators of adipocyte differentiation;
FF mRNA expression is activated by C/EBPalpha and C/EBPdelta [6] [7];
XX
IN T25634 ASC-2; mouse, Mus musculus.
IN T33929 DRIP205-isoform1; human, Homo sapiens.
IN T08973 Hic-5-isoform1; human, Homo sapiens.
IN T05490 Hic-5; human, Homo sapiens.
IN T08641 NCOR1-isoform1; mouse, Mus musculus.
IN T04687 NCOR1; human, Homo sapiens.
IN T01331 RXR-alpha; mouse, Mus musculus.
IN T08433 RXR-alpha; human, Homo sapiens.
XX
MX M00763 V$PPARDR1_Q2.
MX M02262 V$PPARGRXRA_01.
MX M00512 V$PPARG_01.
MX M00515 V$PPARG_02.
MX M00528 V$PPARG_03.
MX M01270 V$PPARG_Q6.
XX
BS R56946.
BS R19271.
BS R27261.
BS R65469.
XX
DR TRANSPATH: MO000033685.
DR EMBL: BC021798; BC021798.
DR EMBL: S79407; MS407.
DR EMBL: U09138;
DR UniProtKB: P37238-1;
XX
RN [1]; RE0009154.
RX PUBMED: 7926726.
RA Tontonoz P., Hu E., Graves R. A., Budavari A. I., Spiegelman B. M.
RT mPPARgamma2: tissue-specific regulator of an adipocyte enhancer
RL Genes Dev. 8:1224-1234 (1994).
RN [2]; RE0011113.
RX PUBMED: 7644514.
RA Zhu Y., Qi C., Korenberg J. R., Chen X.-N., Noya D., Rao M. S., Reddy J. K.
RT Structural organization of mouse peroxisome proliferator-activated receptor gamma (mPPARgamma) gene: Alternative promoter use and different splicing yield two mPPARgamma isoforms
RL Proc. Natl. Acad. Sci. USA 92:7921-7929 (1995).
RN [3]; RE0011203.
RX PUBMED: 8521497.
RA Forman B.M., Tontonoz P., Chen J., Brun R. P., Spiegelman B. M., Evans R. M.
RT 15-Deoxy-delta12,14-prostaglandin J2 is a ligand for the adipocyte determination factor PPARgamma
RL Cell 83:803-812 (1995).
RN [4]; RE0015018.
RX PUBMED: 8001151.
RA Tontonoz P., Hu E., Spiegelman B. M.
RT Stimulation of adipogenesis in fibroblasts by PPAR gamma 2, a lipid-activated transcription factor
RL Cell 79:1147-1156 (1994).
RN [5]; RE0018160.
RX PUBMED: 9030579.
RA Adams M., Reginato M. J., Shao D., Lazar M. A., Chatterjee V. K.
RT Transcriptional activation by peroxisome proliferator-activated receptor gamma is inhibited by phosphorylation at a consensus mitogen-activated protein kinase site.
RL J. Biol. Chem. 272:5128-5132 (1997).
RN [6]; RE0018239.
RX PUBMED: 9367890.
RA Clarke S. L., Robinson C. E., Gimble J. M.
RT CAAT/enhancer binding proteins directly modulate transcription from the peroxisome proliferator-activated receptor gamma 2 promoter.
RL Biochem. Biophys. Res. Commun. 240:99-103 (1997).
RN [7]; RE0018240.
RX PUBMED: 10862621.
RA Elberg G., Gimble J. M., Tsai S. Y.
RT Modulation of the murine peroxisome proliferator-activated receptor gamma 2 promoter activity by CCAAT/enhancer-binding proteins.
RL J. Biol. Chem. 275:27815-27822 (2000).
RN [8]; RE0022242.
RX PUBMED: 12200443.
RA Mueller E., Drori S., Aiyer A., Yie J., Sarraf P., Chen H., Hauser S., Rosen E. D., Ge K., Roeder R. G., Spiegelman B. M.
RT Genetic analysis of adipogenesis through peroxisome proliferator-activated receptor gamma isoforms.
RL J. Biol. Chem. 277:41925-41930 (2002).
RN [9]; RE0025706.
RX PUBMED: 11903058.
RA Krogsdam A. M., Nielsen C. A., Neve S., Holst D., Helledie T., Thomsen B., Bendixen C., Mandrup S., Kristiansen K.
RT Nuclear receptor corepressor-dependent repression of peroxisome-proliferator-activated receptor delta-mediated transactivation.
RL Biochem. J. 363:157-65 (2002).
RN [10]; RE0025974.
RX PUBMED: 9653119.
RA Yuan C. X., Ito M., Fondell J. D., Fu Z. Y., Roeder R. G.
RT The TRAP220 component of a thyroid hormone receptor- associated protein (TRAP) coactivator complex interacts directly with nuclear receptors in a ligand-dependent fashion
RL Proc. Natl. Acad. Sci. USA 95:7939-44 (1998).
RN [11]; RE0027683.
RX PUBMED: 10517671.
RA Monden T., Kishi M., Hosoya T., Satoh T., Wondisford F. E., Hollenberg A. N., Yamada M., Mori M.
RT p120 acts as a specific coactivator for 9-cis-retinoic acid receptor (RXR) on peroxisome proliferator-activated receptor-gamma/RXR heterodimers.
RL Mol. Endocrinol. 13:1695-703 (1999).
RN [12]; RE0047800.
RX PUBMED: 15123625.
RA Ohshima T., Koga H., Shimotohno K.
RT Transcriptional activity of peroxisome proliferator-activated receptor gamma is modulated by SUMO-1 modification.
RL J. Biol. Chem. 279:29551-29557 (2004).
RN [13]; RE0047805.
RX PUBMED: 15687259.
RA Drori S., Girnun G. D., Tou L., Szwaya J. D., Mueller E., Xia K., Shivdasani R. A., Spiegelman B. M.
RT Hic-5 regulates an epithelial program mediated by PPARgamma.
RL Genes Dev. 19:362-375 (2005).
RN [14]; RE0048262.
RX PUBMED: 16210377.
RA Singh R., Artaza J. N., Taylor W. E., Braga M., Yuan X., Gonzalez-Cadavid N. F., Bhasin S.
RT Testosterone inhibits adipogenic differentiation in 3T3-L1 cells: nuclear translocation of androgen receptor complex with beta-catenin and T-cell factor 4 may bypass canonical Wnt signaling to down-regulate adipogenic transcription factors.
RL Endocrinology 147:141-154 (2006).
RN [15]; RE0049238.
RX PUBMED: 16534556.
RA Shimizu M., Yamashita D., Yamaguchi T., Hirose F., Osumi T.
RT Aspects of the regulatory mechanisms of PPAR functions: analysis of a bidirectional response element and regulation by sumoylation.
RL Mol. Cell. Biochem. 286:33-42 (2006).
RN [16]; RE0050597.
RX PUBMED: 10681503.
RA Caira F., Antonson P., Pelto-Huikko M., Treuter E., Gustafsson J. A.
RT Cloning and characterization of RAP250, a novel nuclear receptor coactivator.
RL J. Biol. Chem. 275:5308-5317 (2000).
RN [17]; RE0050761.
RX PUBMED: 15507114.
RA Yamashita D., Yamaguchi T., Shimizu M., Nakata N., Hirose F., Osumi T.
RT The transactivating function of peroxisome proliferator-activated receptor gamma is negatively regulated by SUMO conjugation in the amino-terminal domain.
RL Genes Cells 9:1017-1029 (2004).
RN [18]; RE0068353.
RX PUBMED: 12391167.
RA Akerblad P., Lind U., Liberg D., Bamberg K., Sigvardsson M.
RT Early B-cell factor (O/E-1) is a promoter of adipogenesis and involved in control of genes important for terminal adipocyte differentiation.
RL Mol. Cell. Biol. 22:8015-8025 (2002).
XX
//