TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T02529 XX ID T02529 XX DT 02.12.1998 (created); ewi. DT 13.02.2014 (updated); pro. CO Copyright (C), QIAGEN. XX FA PPARgamma1 XX SY NR1C3; Nuclear receptor subfamily 1 group C member 3; peroxisome proliferator-activated receptor gamma; PPAR-gamma; PPARG; PPARgamma. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G004880 Pparg. XX CL C0002; CC (rec); 2.1.2.5.3.1. XX SZ 475 AA; 54.5 kDa (cDNA) (calc.). XX SQ MVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRADPMV SQ ADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECRVCGDKASGFH SQ YGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRF SQ GRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTT SQ DKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKN SQ IPGFINLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGD SQ FMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLK SQ LNHPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYKDLY XX SC Swiss-Prot#P37238-2 XX FT 13 350 PF00478; IMP dehydrogenase / GMP reductase domai. FT 80 83 consensus MAP kinase site [7]. FT 106 176 SM00399; c4gold. FT 106 180 PS51030; NUCLEAR_REC_DBD_2. FT 107 181 PF00105; Zinc finger, C4 type (two domains). FT 108 173 DNA-binding domain [8]. FT 280 475 ligand-binding domain [8]. FT 285 444 SM00430; holi. FT 288 470 PF00104; Ligand-binding domain of nuclear hormon. XX SF one of two known isoforms produced from alternative promoters and by alternative splicing, see mouse PPAR-gamma T05347 and mouse PPAR-gamma2 T05332 [3]; XX FF activator as a heterodimer with RXR-alpha; FF member of the steroid hormone receptor superfamily; FF expression is under control of C/EBPbeta, probably synergizing with C/EBPdelta, and of glucocorticoids [2]; XX IN T17544 NFATc1b; mouse, Mus musculus. IN T10936 Nrf2-isoform2; human, Homo sapiens. IN T01443 Nrf2; human, Homo sapiens. IN T02529 PPARgamma1; mouse, Mus musculus. IN T01345 RXR-alpha; human, Homo sapiens. IN T21552 SRC-1; Mammalia. XX MX M00763 V$PPARDR1_Q2. MX M02262 V$PPARGRXRA_01. MX M00512 V$PPARG_01. MX M00515 V$PPARG_02. MX M00528 V$PPARG_03. MX M01270 V$PPARG_Q6. XX BS R11480. BS R11481. BS R11482. BS R11483. BS R11484. BS R11485. BS R11486. BS R11487. BS R11488. BS R11489. BS R11585. BS R11490. BS R11491. BS R11492. BS R11493. BS R11494. BS R11495. BS R11496. BS R11497. BS R11498. BS R11499. BS R11500. BS R11501. BS R11502. BS R11503. BS R11504. BS R11505. BS R11506. BS R11507. BS R11508. BS R11509. BS R11510. BS R11511. BS R11512. BS R11513. BS R11514. BS R11515. BS R11516. BS R11517. BS R11518. BS R11519. BS R11520. BS R11521. BS R11522. BS R11523. BS R11524. BS R11525. BS R11526. BS R11527. BS R11528. BS R11529. BS R11530. BS R11531. BS R11532. BS R11533. BS R11534. BS R11535. BS R11536. BS R11537. BS R11538. BS R11539. BS R11540. BS R11541. BS R11542. BS R11543. BS R11544. BS R11545. BS R11546. BS R11547. BS R11548. BS R11549. BS R11550. BS R11551. BS R11555. BS R11556. BS R11557. BS R11558. BS R11559. BS R11560. BS R11561. BS R11562. BS R11563. BS R11564. BS R11565. BS R11566. BS R11567. BS R11568. BS R11572. BS R11573. BS R11574. BS R11575. BS R11576. BS R11577. BS R11578. BS R11579. BS R11580. BS R11581. BS R11582. BS R11583. BS R11584. BS R27483. BS R60266. BS R12750. XX DR TRANSPATH: MO000026509. DR EMBL: S79403; DR EMBL: U01664; DR EMBL: U01841; DR EMBL: U09138; DR EMBL: U10374; DR UniProtKB: P37238-2; PPARG_MOUSE. XX RN [1]; RE0007068. RX PUBMED: 8240342. RA Chen F., Law S. W., O'Malley B. W. RT Identification of two mPPAR related receptors and evidence for the existence of five subfamily members RL Biochem. Biophys. Res. Commun. 196:671-677 (1993). RN [2]; RE0007069. RX PUBMED: 8754811. RA Wu Z., Bucher N. L. R., Farmer S. R. RT Induction of peroxisome proliferator-activated receptor gamma during the conversion of 3T3 fibroblasts into adipocytes is mediated by C/EBPbeta, C/EBPdelta, and glucocorticoids RL Mol. Cell. Biol. 16:4128-4136 (1996). RN [3]; RE0011113. RX PUBMED: 7644514. RA Zhu Y., Qi C., Korenberg J. R., Chen X.-N., Noya D., Rao M. S., Reddy J. K. RT Structural organization of mouse peroxisome proliferator-activated receptor gamma (mPPARgamma) gene: Alternative promoter use and different splicing yield two mPPARgamma isoforms RL Proc. Natl. Acad. Sci. USA 92:7921-7929 (1995). RN [4]; RE0011203. RX PUBMED: 8521497. RA Forman B.M., Tontonoz P., Chen J., Brun R. P., Spiegelman B. M., Evans R. M. RT 15-Deoxy-delta12,14-prostaglandin J2 is a ligand for the adipocyte determination factor PPARgamma RL Cell 83:803-812 (1995). RN [5]; RE0011205. RX PUBMED: 8521498. RA Kliewer S. A., Lenhard J. M., Willson T. M., Patel I., Morris D. C., Lehmann J. M. RT A prostaglandin J2 metabolite binds peroxisome proliferator-activated receptor gamma and promotes adipocyte differentiation RL Cell 83:813-819 (1995). RN [6]; RE0017304. RX PUBMED: 10930400. RA Ikeda Y., Sugawara A., Taniyama Y., Uruno A., Igarashi K., Arima S., Ito S., Takeuchi K. RT Suppression of rat thromboxane synthase gene transcription by peroxisome proliferator-activated receptor gamma in macrophages via an interaction with NRF2 RL J. Biol. Chem. 275:33142-33150 (2000). RN [7]; RE0018160. RX PUBMED: 9030579. RA Adams M., Reginato M. J., Shao D., Lazar M. A., Chatterjee V. K. RT Transcriptional activation by peroxisome proliferator-activated receptor gamma is inhibited by phosphorylation at a consensus mitogen-activated protein kinase site. RL J. Biol. Chem. 272:5128-5132 (1997). RN [8]; RE0018281. RX PUBMED: 8041794. RA Kliewer S. A., Forman B. M., Blumberg B., Ong E. S., Borgmeyer U., Mangelsdorf D. J., Umesono K., Evans R. M. RT Differential expression and activation of a family of murine peroxisome proliferator-activated receptors. RL Proc. Natl. Acad. Sci. USA 91:7355-7359 (1994). RN [9]; RE0034867. RX PUBMED: 15367687. RA Akaike M., Che W., Marmarosh N. L., Ohta S., Osawa M., Ding B., Berk B. C., Yan C., Abe J. RT The hinge-helix 1 region of peroxisome proliferator-activated receptor gamma1 (PPARgamma1) mediates interaction with extracellular signal-regulated kinase 5 and PPARgamma1 transcriptional activation: involvement in flow-induced PPARgamma activation in endothelial cells. RL Mol. Cell. Biol. 24:8691-704 (2004). RN [10]; RE0038010. RX PUBMED: 10347167. RA Heinlein C. A., Ting H. J., Yeh S., Chang C. RT Identification of ARA70 as a ligand-enhanced coactivator for the peroxisome proliferator-activated receptor gamma RL J. Biol. Chem. 274:16147-52 (1999). RN [11]; RE0047835. RX PUBMED: 14573767. RA Chung S. W., Kang B. Y., Kim T. S. RT Inhibition of interleukin-4 production in CD4+ T cells by peroxisome proliferator-activated receptor-gamma (PPAR-gamma) ligands: involvement of physical association between PPAR-gamma and the nuclear factor of activated T cells transcription factor. RL Mol. Pharmacol. 64:1169-1179 (2003). RN [12]; RE0050070. RX PUBMED: 7592593. RA Yu K., Bayona W., Kallen C. B., Harding H. P., Ravera C. P., McMahon G., Brown M., Lazar M. A. RT Differential activation of peroxisome proliferator-activated receptors by eicosanoids. RL J. Biol. Chem. 270:23975-23983 (1995). RN [13]; RE0050168. RX PUBMED: 16267130. RA Liu Y., Zhang Y., Schmelzer K., Lee T. S., Fang X., Zhu Y., Spector A. A., Gill S., Morisseau C., Hammock B. D., Shyy J. Y. RT The antiinflammatory effect of laminar flow: the role of PPARgamma, epoxyeicosatrienoic acids, and soluble epoxide hydrolase. RL Proc. Natl. Acad. Sci. USA 102:16747-16752 (2005). RN [14]; RE0050188. RX PUBMED: 17164145. RA Fang X., Dillon J. S., Hu S., Harmon S. D., Yao J., Anjaiah S., Falck J. R., Spector A. A. RT 20-carboxy-arachidonic acid is a dual activator of peroxisome proliferator-activated receptors alpha and gamma. RL Prostaglandins Other Lipid Mediat. 82:175-184 (2007). RN [15]; RE0050338. RX PUBMED: 11889173. RA Schild R. L., Schaiff W. T., Carlson M. G., Cronbach E. J., Nelson D. M., Sadovsky Y. RT The activity of PPAR gamma in primary human trophoblasts is enhanced by oxidized lipids. RL J. Clin. Endocrinol. Metab. 87:1105-1110 (2002). RN [16]; RE0050364. RX PUBMED: 12573447. RA Soderstrom M., Wigren J., Surapureddi S., Glass C. K., Hammarstrom S. RT Novel prostaglandin D(2)-derived activators of peroxisome proliferator-activated receptor-gamma are formed in macrophage cell cultures. RL Biochim. Biophys. Acta 1631:35-41 (2003). RN [17]; RE0050933. RX PUBMED: 16127449. RA Pascual G., Fong A. L., Ogawa S., Gamliel A., Li A. C., Perissi V., Rose D. W., Willson T. M., Rosenfeld M. G., Glass C. K. RT A SUMOylation-dependent pathway mediates transrepression of inflammatory response genes by PPAR-gamma. RL Nature 437:759-763 (2005). XX //