TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T05295 XX ID T05295 XX DT 22.10.2002 (created); oke. CO Copyright (C), QIAGEN. XX FA PGC-1-isoform1 XX SY Ligand effect modulator 6; peroxisome-proliferator-activated receptor gamma, co-activator 1; PGC-1; PGC-1-alpha; PGC1; PPAR gamma coactivator 1-alpha; PPAR-gamma co-activator 1; PPARGC-1-alpha; PPARGC1. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G004832 PPARGC1A; HGNC: PPARGC1A. XX SZ 798 AA; 91.0 kDa (cDNA) (calc.). XX SQ MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDSFLGGLKWCSD SQ QSEIISNQYNNEPSNIFEKIDEENEANLLAVLTETLDSLPVDEDGLPSFDALTDGDVTTD SQ NEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQLSYNECSGLSTQNHANHNHRIRTNP SQ AIVKTENSWSNKAKSICQQQKPQRRPCSELLKYLTTNDDPPHTKPTENRNSSRDKCTSKK SQ KSHTQSQSQHLQAKPTTLSLPLTPESPNDPKGSPFENKTIERTLSVELSGTAGLTPPTTP SQ PHKANQDNPFRASPKLKSSCKTVVPPPSKKPRYSESSGTQGNNSTKKGPEQSELYAQLSK SQ SSVLTGGHEERKTKRPSLRLFGDHDYCQSINSKTEILINISQELQDSRQLENKDVSSDWQ SQ GQICSSTDSDQCYLRETLEASKQVSPCSTRKQLQDQEIRAELNKHFGHPSQAVFDDEADK SQ TGELRDSDFSNEQFSKLPMFINSGLAMDGLFDDSEDESDKLSYPWDGTQSYSLFNVSPSC SQ SSFNSPCRDSVSPPKSLFSQRPQRMRSRSRSFSRHRSCSRSPYSRSRSRSPGSRSSSRSC SQ YYYESSHYRHRTHRNSPLYVRSRSRSPYSRRPRYDSYEEYQHERLKREEYRREYEKRESE SQ RAKQRERQRQKAIEERRVIYVGKIRPDTTRTELRDRFEVFGEIEECTVNLRDDGDSYGFI SQ TYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKY SQ DSLDFDSLLKEAQRSLRR XX SC translated from EMBL #AF106698 XX FT 146 586 PF00478; IMP dehydrogenase / GMP reductase domain. FT 677 753 PS50102; RRM. FT 678 747 SM00360; rrm1_1. FT 679 745 PF00076; RNA recognition motif. (a.k.a. RRM, RBD, or. XX SF the amino-terminal 190 amino acids of PGC-1-isoform1 are sufficient to mediate a strong interaction with HNF-4alpha transactivation domain [1]; SF the same region is shown to mediate ligand-dependent interactions with AF-2 domains of ERalpha, PPARalpha, GR; SF PGC-1-isoform1 interacts with PPARgamma in a ligand-independent fashion; XX FF It co-activates the LXR/RXR-mediated expression of SREBP-1c T01558, and dexamethasone-stimulated expression of SREBP-2 T01560 [4]; FF co-activator of PPARgamma, PPARalpha, ERalpha; FF co-activator of HNF-4alpha and GR [1]; FF may regulate aspects of hepatic glucose metabolism [1]; XX IN T05682 ERR1-isoform1; human, Homo sapiens. IN T17105 FXR; Mammalia. IN T03828 HNF-4alpha; human, Homo sapiens. IN T00851 T3R-beta1; human, Homo sapiens. IN T08482 VDR-isoform1; human, Homo sapiens. XX BS R32255. XX DR TRANSPATH: MO000033776. DR EMBL: AF106698; AF106698. DR EMBL: AF186379; DR UniProtKB: Q9UBK2; XX RN [1]; RE0018079. RX PUBMED: 11557972. RA Yoon J. C., Puigserver P., Chen G., Donovan J., Wu Z., Rhee J., Adelmant G., Stafford J., Kahn C. R., Granner D. K., Newgard C. B., Spiegelman B. M. RT Control of hepatic gluconeogenesis through the transcriptional coactivator PGC-1. RL Nature 413:131-138 (2001). RN [2]; RE0047400. RX PUBMED: 15908514. RA Savkur R. S., Bramlett K. S., Stayrook K. R., Nagpal S., Burris T. P. RT Coactivation of the human vitamin D receptor by the peroxisome proliferator-activated receptor gamma coactivator-1 alpha. RL Mol. Pharmacol. 68:511-517 (2005). RN [3]; RE0047758. RX PUBMED: 11751919. RA Wu Y., Delerive P., Chin W. W., Burris T. P. RT Requirement of helix 1 and the AF-2 domain of the thyroid hormone receptor for coactivation by PGC-1. RL J. Biol. Chem. 277:8898-8905 (2002). RN [4]; RE0048535. RX PUBMED: 16282353. RA Oberkofler H., Klein K., Felder T. K., Krempler F., Patsch W. RT Role of peroxisome proliferator-activated receptor-gamma coactivator-1alpha in the transcriptional regulation of the human uncoupling protein 2 gene in INS-1E cells. RL Endocrinology 147:966-976 (2006). RN [5]; RE0051163. RX PUBMED: 15329387. RA Savkur R. S., Thomas J. S., Bramlett K. S., Gao Y., Michael L. F., Burris T. P. RT Ligand-dependent coactivation of the human bile acid receptor FXR by the peroxisome proliferator-activated receptor gamma coactivator-1alpha. RL J. Pharmacol. Exp. Ther. 312:170-178 (2005). RN [6]; RE0053654. RX PUBMED: 18441008. RA Greschik H., Althage M., Flaig R., Sato Y., Peluso-Iltis C., Chavant V., Choulier L., Cronet P., Rochel N., Schule R., Stromstedt P. E., Moras D. RT Communication between the ERR alpha homodimer interface and the PGC-1alpha binding surface vie the helix 8-9 loop. RL J. Biol. Chem. 283:20220-20230 (2008). RN [7]; RE0067583. RX PUBMED: 20661474. RA Kong X., Wang R., Xue Y., Liu X., Zhang H., Chen Y., Fang F., Chang Y. RT Sirtuin 3, a New Target of PGC-1alpha, Plays an Important Role in the Suppression of ROS and Mitochondrial Biogenesis. RL PLoS ONE 5:e11707 (2010). XX //