TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01558 XX ID T01558 XX DT 14.09.1995 (created); ewi. DT 21.07.2014 (updated); yre. CO Copyright (C), QIAGEN. XX FA SREBP-1c XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G003956 SREBF1; HGNC: SREBF1. XX CL C0012; bHLH-ZIP; 1.2.6.3.1.3. XX SZ 1047 AA; 111.1 kDa (cDNA) (calc.). XX SQ MDCTFEDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLE SQ AFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGAL SQ LPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQ SQ VQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKA SQ AGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQSRGEK SQ RTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQEN SQ LSLRTAVHKSKSLKDLVSACGSGGNTDVLMEGVKTEVEDTLTPPPSDAGSPFQSSPLSLG SQ SRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSRGMLDRSRLALCTLVFLCLSCNPLA SQ SLLGARGLPSPSDTTSVYHSPGRNVLGTESRDGPGWAQWLLPPVVWLLNGLLVLVSLVLL SQ FVYGEPVTRPHSGPAVYFWRHRKQADLDLARGDFAQAAQQLWLALRALGRPLPTSHLDLA SQ CSLLWNLIRHLLQRLWVGRWLAGRAGGLQQDCALRVDASASARDAALVYHKLHQLHTMGK SQ HTGGHLTATNLALSALNLAECAGDAVSVATLAEIYVAAALRVKTSLPRALHFLTRFFLSS SQ ARQACLAQSGSVPPAMQWLCHPVGHRFFVDGDWSVLSTPWESLYSLAGNPVDPLAQVTQL SQ FREHLLERALNCVTQPNPSPGSADGDKEFSDALGYLQLLNSCSDAAGAPAYSFSISSSMA SQ TTTGVDPVAKWWASLTAVVIHWLRRDEEAAERLCPLVEHLPRVLQESERPLPRAALHSFK SQ AARALLGCAKAESGPASLTICEKASGYLQDSLATTPASSSIDKAVQLFLCDLLLVVRTSL SQ WRQQQPPAPAPAAQGASSRPQASALELRGFQRDLSSLRRLAQSFRPAMRRLMDVLTSESA SQ WALPQHLGKGFPSPSGHKVPGWHGRMD XX SC translated from EMBL #U00968 and edited XX FT 1 5 replaced by 1-29 in SREBP-1a and -1b [3]. FT 1 389 PF00478; IMP dehydrogenase / GMP reductase domain. FT 298 350 PS50888; HLH. FT 300 350 PF00010; Helix-loop-helix DNA-binding domain. FT 305 355 SM00353; finulus. FT 1011 1047 replaced by 1035-1147 in SREBP-1a [3]. XX SF The isoforms SREBP-1a and SREBP-1c differ only at their extreme N termini, SREBP-1c lacks 28 AA present in SREBP-1a and instead contains 4 unique AA of its own [10]; SF one of the three splice variants, for others see SREBP-1a T01556 and SREBP-1b T01557; SF bHLH domain exhibits 44% identity with TFE3 [2]; SF in cell extracts, N-terminal proteolytically processed proteins of 59-68 kDa are found to bind to sterol regulatory elements [1] [4]; SF the mature factor then translocates to the nucleus [4]; XX CP adult: high in liver, adrenal gland, lower in muscle, kidney, placenta, very low in lung, nearly undetectable in pancreas, brain, heart; fetal: highest levels in liver, lung, lower in kidney, very low in heart, brain [2]. XX FF can form a complex with E47 and BETA2 on insulin promoter mediated through the E-box [8]; FF Its expression is enhanced by LXR-specific ligand 22(R)HC, retinoid X receptor (RXR) ligand 9cRA, or PGC-1alpha T05295, and such enhancement is reduced by SHP T02738 [5]; FF suppressed basal vascular endothelial growth factor (VEGF) promoter activities [7]; FF FKHRL1 and SREBP1-c added together showed SREBP-1c inhibited the binding of FKHRL1 to the IRS-2 promoter in a dose dependent manner. [9]; FF transcriptional activator, acting through sterol regulatory elements (SRE) [3]; FF sterols may reduce or enhance trans-activation, depending on the amount of SREBP-1 (or cofactors) present [3]; FF SREBP-1 precursors are attached to the nuclear envelope and to the ER [4]; XX IN T02423 HNF-4alpha2; mouse, Mus musculus. XX MX M00220 V$SREBP1_01. MX M00221 V$SREBP1_02. MX M01173 V$SREBP1_Q5. MX M00749 V$SREBP1_Q6. MX M04632 V$SREBP1_Q6_01. MX M00776 V$SREBP_Q3. MX M01168 V$SREBP_Q6. XX BS R24183. BS R30818. BS R30112. BS R30113. BS R18671. BS R18672. BS R28157. BS R21578. BS R19455. BS R37141. BS R37142. BS R31911. BS R24626. BS R24625. BS R19288. BS R30415. BS R04919. BS R04920. XX DR TRANSPATH: MO000025763. DR EMBL: U00968; DR UniProtKB: P36956-3; XX RN [1]; RE0003430. RX PUBMED: 8314806. RA Wang X., Briggs M. R., Hua X., Yokoyama C., Goldstein J. L., Brown M. S. RT Nuclear protein that binds sterol regulatory element of low density lipoprotein receptor promoter (2. Purification and characterization) RL J. Biol. Chem. 268:14497-14504 (1993). RN [2]; RE0003432. RX PUBMED: 2298751. RA Smith J. R., Osborne T. F., Goldstein J. L., Brown M. S. RT Identification of nucleotides responsible for enhancer activity of sterol regulatory element in low density lipoprotein receptor genes RL J. Biol. Chem. 265:2306-2310 (1990). RN [3]; RE0003434. RX PUBMED: 8402897. RA Yokoyama C., Wang X., Briggs M. R., Admon A., Wu J., Hua X., Goldstein J., Brown M. S. RT SREBP-1, a basic helix-loop-helix leucine zipper protein that controls transcription of the low density lipoprotein receptor gene RL Cell 75:187-197 (1993). RN [4]; RE0003435. RX PUBMED: 8156598. RA Wang X., Sato R. R., Brown M. S., Hua X., Goldstein J. L. RT SREBP-1, a membrane-bound transcription factor released by sterol-regulated proteolysis RL Cell 77:53-62 (1994). RN [5]; RE0048535. RX PUBMED: 16282353. RA Oberkofler H., Klein K., Felder T. K., Krempler F., Patsch W. RT Role of peroxisome proliferator-activated receptor-gamma coactivator-1alpha in the transcriptional regulation of the human uncoupling protein 2 gene in INS-1E cells. RL Endocrinology 147:966-976 (2006). RN [6]; RE0051054. RX PUBMED: 17636037. RA Ponugoti B., Fang S., Kemper J. K. RT Functional interaction of HNF-4 and PGC-1{alpha} in CYP7A1 regulation is inhibited by a key lipogenic activator, SREBP-1c. RL Mol. Endocrinol. 11:2698-712 (2007). RN [7]; RE0047696. RX PUBMED: 16480961. RA Motoyama K., Fukumoto S., Koyama H., Emoto M., Shimano H., Maemura K., Nishizawa Y. RT SREBP inhibits VEGF expression in human smooth muscle cells. RL Biochem. Biophys. Res. Commun. 342:354-360 (2006). RN [8]; RE0047700. RX PUBMED: 16055439. RA Amemiya-Kudo M., Oka J., Ide T., Matsuzaka T., Sone H., Yoshikawa T., Yahagi N., Ishibashi S., Osuga J., Yamada N., Murase T., Shimano H. RT Sterol regulatory element-binding proteins activate insulin gene promoter directly and indirectly through synergy with BETA2/E47. RL J. Biol. Chem. 280:34577-34589 (2005). RN [9]; RE0047892. RX PUBMED: 15048126. RA Ide T., Shimano H., Yahagi N., Matsuzaka T., Nakakuki M., Yamamoto T., Nakagawa Y., Takahashi A., Suzuki H., Sone H., Toyoshima H., Fukamizu A., Yamada N. RT SREBPs suppress IRS-2-mediated insulin signalling in the liver. RL Nat. Cell Biol. 6:351-357 (2004). RN [10]; RE0047938. RX PUBMED: 15340088. RA Toth J. I., Datta S., Athanikar J. N., Freedman L. P., Osborne T. F. RT Selective coactivator interactions in gene activation by SREBP-1a and -1c. RL Mol. Cell. Biol. 24:8288-8300 (2004). XX //