TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T08469 XX ID T08469 XX DT 24.01.2006 (created); jag. DT 09.04.2015 (updated); mka. CO Copyright (C), QIAGEN. XX FA Nrf2 XX SY NF-E2 related factor 2; NFE2-related factor 2; NFE2L2; NRF-2; NRF2; nuclear factor, erythroid derived 2, like 2. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G002918 Nfe2l2. XX CL C0008; bZIP. XX SZ 597 AA; 66.9 kDa (cDNA) (calc.). XX SQ MMDLELPPPGLQSQQDMDLIDILWRQDIDLGVSREVFDFSQRQKDYELEKQKKLEKERQE SQ QLQKEQEKAFFAQFQLDEETGEFLPIQPAQHIQTDTSGSASYSQVAHIPKQDALYFEDCM SQ QLLAETFPFVDDHESLALDIPSHAESSVFTAPHQAQSLNSSLEAAMTDLSSIEQDMEQVW SQ QELFSIPELQCLNTENKQLADTTAVPSPEATLTEMDSNYHFYSSISSLEKEVGNCGPHFL SQ HGFEDSFSSILSTDDASQLTSLDSNPTLNTDFGDEFYSAFIAEPSDGGSMPSSAAISQSL SQ SELLDGTIEGCDLSLCKAFNPKHAEGTMEFNDSDSGISLNTSPSRASPEHSVESSIYGDP SQ PPGFSDSEMEELDSAPGSVKQNGPKAQPAHSPGDTVQPLSPAQGHSAPMRESQCENTTKK SQ EVPVSPGHQKAPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVDDFNEMMSKE SQ QFNEAQLALIRDIRRRGKNKVAAQNCRKRKLENIVELEQDLGHLKDEREKLLREKGENDR SQ NLHLLKRRLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKPDTKKN XX SC translated from EMBL #U70475 XX FT 98 433 PF00478; IMP dehydrogenase / GMP reductase domain. FT 487 551 PF00170; bZIP transcription factor. FT 487 551 SM00338; brlzneu. FT 489 552 PS50217; BZIP. XX IN T05451 BRG1; human, Homo sapiens. IN T16987 BRG1; Mammalia. IN T18378 CBP; human, Homo sapiens. IN T18396 CRBN; mouse, Mus musculus. IN T13786 KEAP1; rat, Rattus norvegicus. IN T25824 KEAP1; rat, Rattus norvegicus. IN T08348 RXR-alpha; mouse, Mus musculus. IN T08965 RXR-alpha; monkey, Cercopithecus aethiops. XX MX M07296 V$MAF_Q4. MX M00983 V$MAF_Q6_01. MX M07610 V$NRF2_Q3. MX M00821 V$NRF2_Q4. MX M07265 V$NRF2_Q4_01. MX M03835 V$NRF2_Q6. XX BS R66682. BS R22532. BS R67075. XX DR TRANSPATH: MO000058424. DR TRANSCOMPEL: C00490. DR EMBL: U20532; DR EMBL: U70474; DR EMBL: U70475; DR UniProtKB: Q60795; XX RN [1]; RE0035897. RX PUBMED: 15292179. RA Papaiahgari S., Kleeberger S. R., Cho H. Y., Kalvakolanu D. V., Reddy S. P. RT NADPH oxidase and ERK signaling regulates hyperoxia-induced Nrf2-ARE transcriptional response in pulmonary epithelial cells. RL J. Biol. Chem. 279:42302-42312 (2004). RN [2]; RE0047997. RX PUBMED: 15870285. RA Ki S. H., Cho I. J., Choi D. W., Kim S. G. RT Glucocorticoid receptor (GR)-associated SMRT binding to C/EBPbeta TAD and Nrf2 Neh4/5: role of SMRT recruited to GR in GSTA2 gene repression. RL Mol. Cell. Biol. 25:4150-4165 (2005). RN [3]; RE0050591. RX PUBMED: 11439354. RA Dhakshinamoorthy S., Jaiswal A. K. RT Functional characterization and role of INrf2 in antioxidant response element-mediated expression and antioxidant induction of NAD(P)H:quinone oxidoreductase1 gene. RL Oncogene 20:3906-3917 (2001). RN [4]; RE0051053. RX PUBMED: 15367669. RA Cullinan S. B., Gordan J. D., Jin J., Harper J. W., Diehl J. A. RT The Keap1-BTB protein is an adaptor that bridges Nrf2 to a Cul3-based E3 ligase: oxidative stress sensing by a Cul3-Keap1 ligase. RL Mol. Cell. Biol. 24:8477-8486 (2004). RN [5]; RE0052122. RX PUBMED: 16551619. RA Salazar M., Rojo A. I., Velasco D., de Sagarra R. M., Cuadrado A. RT Glycogen synthase kinase-3beta inhibits the xenobiotic and antioxidant cell response by direct phosphorylation and nuclear exclusion of the transcription factor Nrf2. RL J. Biol. Chem. 281:14841-14851 (2006). RN [6]; RE0052140. RX PUBMED: 16923960. RA Zhang J., Ohta T., Maruyama A., Hosoya T., Nishikawa K., Maher J. M., Shibahara S., Itoh K., Yamamoto M. RT BRG1 interacts with Nrf2 to selectively mediate HO-1 induction in response to oxidative stress. RL Mol. Cell. Biol. 26:7942-7952 (2006). RN [7]; RE0052235. RX PUBMED: 16785233. RA He X., Chen M. G., Lin G. X., Ma Q. RT Arsenic induces NAD(P)H-quinone oxidoreductase I by disrupting the Nrf2 x Keap1 x Cul3 complex and recruiting Nrf2 x Maf to the antioxidant response element enhancer. RL J. Biol. Chem. 281:23620-23631 (2006). RN [8]; RE0052325. RX PUBMED: 17313370. RA Zhang J., Hosoya T., Maruyama A., Nishikawa K., Maher J. M., Ohta T., Motohashi H., Fukamizu A., Shibahara S., Itoh K., Yamamoto M. RT Nrf2 Neh5 domain is differentially utilized in the transactivation of cytoprotective genes. RL Biochem. J. 404:459-466 (2007). RN [9]; RE0070335. RX PUBMED: 21245377. RA Rada P., Rojo A. I., Chowdhry S., McMahon M., Hayes J. D., Cuadrado A. RT SCF/{beta}-TrCP promotes glycogen synthase kinase 3-dependent degradation of the Nrf2 transcription factor in a Keap1-independent manner. RL Mol. Cell. Biol. 31:1121-1133 (2011). XX //