AC T09250
AS T06107.
XX
ID T09250
XX
DT 22.08.2006 (created); sla.
DT 20.08.2015 (updated); sup.
CO Copyright (C), QIAGEN.
XX
FA ipf1
XX
SY glucose sensitive factor; GSF; IDX-1; insulin promoter factor 1; insulin upstream factor 1; IPF-1; islet/duodenum homeobox 1; IUF-1; IUF1; pancreas/duodenum homeobox 1; pancreas/duodenum homeobox-1; Pdx-1; Pdx1; somatostatin transactivating factor-1; STF-1; STF1.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G002249 PDX1; HGNC: Pdx1.
XX
CL C0006; homeo.
XX
SZ 283 AA; 30.8 kDa (cDNA) (calc.).
XX
SQ MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPFPGALGALEQG
SQ SPPDISPYEVPPLADDPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFP
SQ WMKSTKAHAWKGQWAGGAYAAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELA
SQ VMLNLTERHIKIWFQNRRMKWKKEEDKKRGGGTAVGGGGVAEPEQDCAVTSGEELLALPP
SQ PPPPGGAVPPAAPVAAREGRLPPGLSASPQPSSVAPRRPQEPR
XX
SC translated from EMBL #U35632
XX
FT 144 204 
PS50071; HOMEOBOX_2.
FT 146 208 
SM00389; HOX_1.
FT 147 203 
PF00046; Homeobox domain.
XX
IN T27121 E47:BETA2; Mammalia.
IN T09404 HNF-3beta; Mammalia.
IN T01427 p300; human, Homo sapiens.
IN T09966 Pbx1; Mammalia.
IN T05351 PPARgamma; human, Homo sapiens.
XX
MX M01233 V$IPF1_01.
MX M01234 V$IPF1_02.
MX M01235 V$IPF1_03.
MX M01236 V$IPF1_04.
MX M01255 V$IPF1_05.
MX M01438 V$IPF1_06.
MX M00436 V$IPF1_Q4.
MX M01013 V$IPF1_Q4_01.
MX M02096 V$IPF1_Q5.
MX M04614 V$IPF1_Q5_01.
MX M01275 V$IPF1_Q6.
XX
BS R15483.
BS R64436.
BS R69324.
BS R19482.
BS R02709.
BS R69326.
BS R69329.
BS R18137.
BS R15491.
BS R15493.
BS R21222.
BS R14769.
BS R15482.
BS R15492.
XX
DR TRANSPATH: MO000085445.
DR EMBL: AF035259;
DR EMBL: AF035260;
DR EMBL: S82168;
DR EMBL: S82178;
DR EMBL: U30329;
DR EMBL: U35632;
DR EMBL: X99894;
DR UniProtKB: P52945;
XX
RN [1]; RE0000909.
RX PUBMED: 2186040.
RA Boam D. S. W., Clark A. R., Docherty K.
RT Positive and Negative Regulation of the Human Insulin Gene by Multiple Trans-acting Factors
RL J. Biol. Chem. 265:8285-8296 (1990).
RN [2]; RE0002878.
RX PUBMED: 1915886.
RA Scott V., Clark A. R., Hutton J. C., Docherty K.
RT Two proteins act as the IUF1 insulin gene enhancer binding factor
RL FEBS Lett. 290:27-30 (1991).
RN [3]; RE0002995.
RX PUBMED: 1406648.
RA Shelton K. D., Franklin A. J., Khoor A., Beechem J., Magnuson M. A.
RT Multiple elements in the upstream glucokinase promoter contrbute to transcription in insulinoma cells
RL Mol. Cell. Biol. 12:4578-4589 (1992).
RN [4]; RE0011841.
RX PUBMED: 8524276.
RA Peers B., Sharma S., Johnson T., Kamps M., Montminy M.
RT The pancreatic islet factor STF-1 binds cooperatively with Pbx to a regulatory element in the somatostain promoter: importance of the FPWMK motif and of the homeodomain
RL Mol. Cell. Biol. 15:7091-7097 (1995).
RN [5]; RE0015827.
RX PUBMED: 9252422.
RA Macfarlane W. M., Smith S. B., James R. F., Clifton A. D., Doza Y. N., Cohen P., Docherty K.
RT The p38/reactivating kinase mitogen-activated protein kinase cascade mediates the activation of the transcription factor insulin upstream factor 1 and insulin gene transcription by high glucose in pancreatic beta-cells
RL J. Biol. Chem. 272:20936-20944 (1997).
RN [6]; RE0015831.
RX PUBMED: 2690822.
RA Boam D. S., Docherty K.
RT A tissue-specific nuclear factor binds to multiple sites in the human insulin-gene enhancer
RL Biochem. J. 264:233-239 (1989).
RN [7]; RE0015832.
RX PUBMED: 10545531.
RA Hani E. H., Stoffers D. A., Chevre J. C., Durand E., Stanojevic V., Dina C., Habener J. F., Froguel P.
RT Defective mutations in the insulin promoter factor-1 (IPF-1) gene inlate-onset type 2 diabetes mellitus
RL J. Clin. Invest. 104:R41-R48 (1999).
RN [8]; RE0015833.
RX PUBMED: 10545530.
RA Macfarlane W. M., Frayling T. M., Ellard S., Evans J. C., Allen L. I., Bulman M. P., Ayres S., Shepherd M., Clark P., Millward A., Demaine A., Wilkin T., Docherty K., Hattersley A. T.
RT Missense mutations in the insulin promoter factor-1 gene predispose to type 2 diabetes
RL J. Clin. Invest. 104:R33-R39 (1999).
RN [9]; RE0015839.
RX PUBMED: 7590740.
RA Stoffel M., Stein R., Wright C. V., Espinosa R., Le Beau M. M., Bell G. I.
RT Localization of human homeodomain transcription factor insulin promoter factor 1 (IPF1) to chromosome band 13q12.1
RL Genomics 28:125-126 (1995).
RN [10]; RE0016132.
RX PUBMED: 8988180.
RA Stoffers D. A., Zinkin N. T., Stanojevic V., Clarke W. L., Habener J. F.
RT Pancreatic agenesis attributable to a single nucleotide deletion in the human IPF1 gene coding sequence.
RL Nat. Genet. 15:106-110 (1997).
RN [11]; RE0016240.
RX PUBMED: 8635654.
RA Inoue H., Riggs A. C., Tanizawa Y., Ueda K., Kuwano A., Liu L., Donis-Keller H., Permutt M. A.
RT Isolation, characterization, and chromosomal mapping of the human insulin promoter factor 1 (IPF-1) gene.
RL Diabetes 45:789-794 (1996).
RN [12]; RE0020529.
RX PUBMED: 10585868.
RA Wu H., Macfarlane W. M., Tadayyon M., Arch J. R., James R. F., Docherty K.
RT Insulin stimulates pancreatic-duodenal homoeobox factor-1 (PDX1) DNA-binding activity and insulin promoter activity in pancreatic beta cells
RL Biochem. J. 344:813-818 (1999).
RN [13]; RE0068299.
RX PUBMED: 12970316.
RA Schwitzgebel V. M., Mamin A., Brun T., Ritz-Laser B., Zaiko M., Maret A., Jornayvaz F. R., Theintz G. E., Michielin O., Melloul D., Philippe J.
RT Agenesis of human pancreas due to decreased half-life of insulin promoter factor 1.
RL J. Clin. Endocrinol. Metab. 88:4398-4406 (2003).
XX
//