TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09128 XX ID T09128 XX DT 26.07.2006 (created); kau. DT 06.12.2013 (updated); spk. CO Copyright (C), QIAGEN. XX FA LAP*-NF-M XX SY AGP/EBP; ANF-2; C/EBP beta; C/EBPbeta; CCAAT Enhancer Binding Protein beta; CCAAT/enhancer binding protein beta; CR protein; CRP2; H-APF-2; IL-6DBP; LAP1; liver-enriched activator protein; NF-IL6; NF-M; transcription factor NF-M. XX OS chick, Gallus gallus OC eukaryota; animalia; metazoa; chordata; vertebrata; aves; neornithes; neognathae; galliformes; phasianidae XX GE G037111 CEBPB. XX CL C0008; bZIP. XX SZ 328 AA; 35.0 kDa (cDNA) (calc.). XX SQ MQRLVAWDAACLPIQPPAFKSMEVANFYYEADCLAALNKLHPRAAGGRSMTELTVGDHER SQ AIDFSPYLDPLAASQQPAQPPPPAAAAGGNFEPACSSGGQDFLSDLFAEDYKGSGGGKKP SQ DYTYISLTRHGHPCGSQSHKPGVLPGCFPPQIVETKVEPVFETLDSCKGPRKEEGGAGPG SQ PGGMSSPYGSTVRSYLGYQSVPSGSSGNLSTSSSSSPPGTPNPSESSKSAAGAGGYSGPP SQ AGKNKPKKCVDKHSDEYKLRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKV SQ EQLSRELSTLRNLFKQLPEPLLASSPRC XX SC Swiss-Prot#Q05826 XX FT 118 131 conserved region 5, repressing region [2]. FT 184 222 conserved region 7, repressing region [2]. FT 252 316 SM00338; brlzneu. FT 253 306 PF07716; Basic region leucine zipper. FT 254 317 PS50217; BZIP. XX SF One of three forms encoded by the chicken CEBPbeta gene that results from the usage of different in frame AUGs as the starting codon of the same mRNA species. [7]; SF The longest form [7]; XX FF Activator [7]; XX IN T05452 BAF155; human, Homo sapiens. IN T08548 BRG1-isoform1; human, Homo sapiens. IN T09280 NeuroD; mouse, Mus musculus. IN T01427 p300; human, Homo sapiens. XX MX M00109 V$CEBPB_01. MX M00117 V$CEBPB_02. MX M07315 V$CEBPB_Q3. MX M01896 V$CEBPB_Q6. MX M00912 V$CEBP_Q2_01. MX M00770 V$CEBP_Q3. XX DR TRANSPATH: MO000083685. DR EMBL: X70813; DR EMBL: Z21646; DR UniProtKB: Q05826; XX RN [1]; RE0003031. RX PUBMED: 8467792. RA Katz S., Kowenz-Leutz E., Mueller C., Meese K., Ness S. A., Leutz A. RT The NF-M transcription factor is related to C/EBPbeta and plays a role in signal transduction, differentiation and leukemogenesis of avian myelomonocytic cells RL EMBO J. 12:1321-1332 (1993). RN [2]; RE0003033. RX PUBMED: 7958933. RA Kowenz-Leutz E., Twamley G., Ansieau S., Leutz A. RT Novel mechanism of C/EBPbeta (NF-M) transcriptional control: activation through derepression RL Genes Dev. 8:2781-2791 (1994). RN [3]; RE0003514. RX PUBMED: 8491193. RA Burk O., Mink S., Ringwald M., Klempnauer K.-H. RT Synergistic activation of the chicken mim-1 gene by v-myb and C/EBP transcription factors RL EMBO J. 12:2027-2038 (1993). RN [4]; RE0006629. RX PUBMED: 8657104. RA Mink S., Kerber U., Klempnauer K.-H. RT Interaction of C/EBPbeta and v-myb is required for synergistic activation of the mim-1 gene RL Mol. Cell. Biol. 16:1316-1325 (1996). RN [5]; RE0037509. RX PUBMED: 14759369. RA Mo X., Kowenz-Leutz E., Xu H., Leutz A. RT Ras induces mediator complex exchange on C/EBP beta RL Mol. Cell 13:241-50 (2004). RN [6]; RE0047943. RX PUBMED: 9343424. RA Mink S., Haenig B., Klempnauer K. H. RT Interaction and functional collaboration of p300 and C/EBPbeta. RL Mol. Cell. Biol. 17:6609-6617 (1997). RN [7]; RE0047994. RX PUBMED: 10619021. RA Kowenz-Leutz E., Leutz A. RT A C/EBP beta isoform recruits the SWI/SNF complex to activate myeloid genes. RL Mol. Cell 4:735-743 (1999). RN [8]; RE0050079. RX PUBMED: 17254333. RA Calella A. M., Nerlov C., Lopez R. G., Sciarretta C., von Bohlen Und Halbach O., Bereshchenko O., Minichiello L. RT Neurotrophin/Trk receptor signaling mediates C/EBPalpha, -beta and NeuroD recruitment to immediate-early gene promoters in neuronal cells and requires C/EBPs to induce immediate-early gene transcription. RL Neural Develop. 2:4 (2007). XX //