
AC T09150
XX
ID T09150
XX
DT 31.07.2006 (created); res.
DT 11.01.2016 (updated); sla.
CO Copyright (C), QIAGEN.
XX
FA pax-6-isoform1
XX
SY mPax-6; mPax6; Pax-6; PAX6; pax6-isoform1; Sey; Small eye.
XX
OS mouse, Mus musculus
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae
XX
GE G009200 Pax6.
XX
CL C0018; paired-homeo; 3.2.1.2.2.1.
XX
SZ 422 AA; 46.7 kDa (cDNA) (calc.).
XX
SQ MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRY
SQ YETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSV
SQ SSINRVLRNLASEKQQMGADGMYDKLRMLNGQTGSWGTRPGWYPGTSVPGQPTQDGCQQQ
SQ EGGGENTNSISSNGEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFAR
SQ ERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRRQASNTPSHIPISSSFSTSVYQPIP
SQ QPTTPVSSFTSGSMLGRTDTALTNTYSALPPMPSFTMANNLPMQPPVPSQTSSYSCMLPT
SQ SPSVNGRSYDTYTPPHMQTHMNSQPMGTSGTTSTGLISPGVSVPVQVPGSEPDMSQYWPR
SQ LQ
XX
SC Swiss-Prot#P63015-1
XX
FT 4 128
PF00292; 'Paired box' domain.
FT 4 128
SM00351; pax3.
FT 4 130
PS51057; PAIRED_2.
FT 57 415
PF00478; IMP dehydrogenase / GMP reductase domain.
FT 208 268
PS50071; HOMEOBOX_2.
FT 210 266
PS50552; PAX.
FT 210 272
SM00389; HOX_1.
FT 211 267
PF00046; Homeobox domain.
XX
IN T01427 p300; human, Homo sapiens.
XX
MX M00097 V$PAX6_01.
MX M01391 V$PAX6_02.
MX M00979 V$PAX6_Q2.
MX M00808 V$PAX_Q6.
XX
BS R03013.
BS R08833.
BS R08828.
BS R08840.
BS R08838.
BS R08836.
BS R08529.
BS R08530.
BS R08532.
BS R08831.
BS R08832.
BS R08827.
BS R08837.
BS R08834.
BS R08829.
BS R08839.
BS R00582.
BS R08703.
BS R08777.
BS R20688.
BS R08830.
BS R08705.
BS R08826.
BS R08835.
BS R08706.
BS R08825.
XX
DR TRANSPATH: MO000083905.
DR EMBL: X63963;
DR EMBL: X82150;
DR UniProtKB: P63015-1;
XX
RN [1]; RE0002821.
RX PUBMED: 1684639.
RA Hill R. E., Favor J., Hogan B. L. M., Ton C. C. T., Saunders G. F., Hanson I. M., Prosser J., Jordan T., Hastie N. D., van Heyningen V.
RT Mouse Small eye results from mutations in a paired-like homeobox-containing gene
RL Nature 354:522-525 (1991).
RN [2]; RE0004257.
RX PUBMED: 1685142.
RA Walther C., Guenet J. L., Simon D., Deutsch U., Jostes B., Goulding M. D., Plachov D., Balling R., Gruss P.
RT Pax: a murine multigene family of paired box-containing genes
RL Genomics 11:424-434 (1991).
RN [3]; RE0004258.
RX PUBMED: 1687460.
RA Walther C., Gruss P.
RT Pax-6, a murine paired box gene, is expressed in the developing CNS
RL Development 113:1435-1449 (1991).
RN [4]; RE0006040.
RX PUBMED: 9224716.
RA Sander M., Neubueser A., Kalamaras J., Ee H. C., Martin G. R., German M. S.
RT Genetic analysis reveals that PAX6 is required for normal transcription of pancreatic hormone genes and islet development
RL Genes Dev. 11:1662-1673 (1997).
RN [5]; RE0006130.
RX PUBMED: 9163426.
RA St-Onge L., Sosa-Pineda B., Chowdhury K., Mansouri A., Gruss P.
RT Pax6 is required for differentiation of glucagon-producing alpha -cells in mouse pancreas
RL Nature 387:406-409 (1997).
RN [6]; RE0011033.
RX PUBMED: 7753863.
RA Richardson J., Cvekl A., Wistow G.
RT Pax-6 is essential for lens-specific expression of zeta-crystallin
RL Proc. Natl. Acad. Sci. USA 92:4676-4680 (1995).
RN [7]; RE0012625.
RX PUBMED: 8600027.
RA Quinn J. C., West J. D., Hill R. E.
RT Multiple functions for Pax6 in mouse eye and nasal development
RL Genes Dev. 10:435-446 (1996).
RN [8]; RE0012695.
RX PUBMED: 8689689.
RA Schedl A., Ross A., Lee M., Engelkamp D., Rashbass P., van Heyningen V., Hastie N. D.
RT Influence of PAX6 gene dosage on development: overexpression causes sevre eye abnormalities
RL Cell 86:71-82 (1996).
RN [9]; RE0013854.
RX PUBMED: 10478839.
RA Hill M. E., Asa S. L., Drucker D. J.
RT Essential requirement for Pax6 in control of enteroendocrine proglucagon gene transcription
RL Mol. Endocrinol. 13:1474-1486 (1999).
RN [10]; RE0014020.
RX PUBMED: 7917011.
RA Chalepakis G., Wijnholds J., Giese P., Schachner M., Gruss P.
RT Characterization of Pax-6 and Hoxa-1 binding to the promoter region of the neural cell adhesion molecule L1
RL DNA Cell Biol. 13:891-900 (1994).
RN [11]; RE0014123.
RX PUBMED: 10567553.
RA Fujitani Y., Kajimoto Y., Yasuda T., Matsuoka T. A., Kaneto H., Umayahara Y., Fujita N., Watada H., Miyazaki J. I., Yamasaki Y., Hori M.
RT Identification of a portable repression domain and an E1A-responsive activation domain in Pax4: a possible role of Pax4 as a transcriptional repressor in the pancreas
RL Mol. Cell. Biol. 19:8281-8291 (1999).
RN [12]; RE0014138.
RX PUBMED: 10567552.
RA Smith S. B., Ee H. C., Conners J. R., German M. S.
RT Paired-homeodomain transcription factor PAX4 acts as a transcriptional repressor in early pancreatic development
RL Mol. Cell. Biol. 19:8272-8280 (1999).
RN [13]; RE0014292.
RX PUBMED: 10717483.
RA Zhou Y., Zheng J. B., Gu X., Li W., Saunders G. F.
RT A novel Pax-6 binding site in rodent B1 repetitive elements: coevolution between developmental regulation and repeated elements
RL Gene 245:319-328 (2000).
RN [14]; RE0014449.
RX PUBMED: 9636075.
RA Hallonet M., Hollemann T., Wehr R., Jenkins N. A., Copeland N. G., Pieler T., Gruss P.
RT Vax1 is a novel homeobox-containing gene expressed in the developing anterior ventral forebrain
RL Development 125:2599-2610 (1998).
RN [15]; RE0062609.
RX PUBMED: 16115881.
RA Grinchuk O., Kozmik Z., Wu X., Tomarev S.
RT The Optimedin gene is a downstream target of Pax6.
RL J. Biol. Chem. 280:35228-35237 (2005).
RN [16]; RE0062650.
RX PUBMED: 16407227.
RA Kim E. A., Noh Y. T., Ryu M. J., Kim H. T., Lee S. E., Kim C. H., Lee C., Kim Y. H., Choi C. Y.
RT Phosphorylation and transactivation of Pax6 by homeodomain-interacting protein kinase 2.
RL J. Biol. Chem. 281:7489-7497 (2006).
XX
//