AC T00163
AS T01108.
XX
ID T00163
XX
DT 15.10.1992 (created); ewi.
DT 09.04.2014 (updated); vad.
CO Copyright (C), QIAGEN.
XX
FA CREB-A
XX
SY ATF-47; CREB; CREB-341; CREB-A; CREB-isoform1; CREB1; CREBalpha; cyclic AMP response element-binding protein; Cyclic AMP Responsive Element Binging factor; X2-box binding protein; X2BP.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G004624 CREB1; HGNC: CREB1.
XX
HO ATF, 47-kDa protein, EIIA-EF, EPF, EIIaE-B.
XX
CL C0008; bZIP; 1.1.7.1.1.1.
XX
SZ 341 AA; 36.7 kDa (cDNA) (calc.).
XX
SQ MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
SQ GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQ SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
SQ QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
SQ VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
SQ RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
XX
SC Swiss-Prot#P16220-1
XX
FT 23 338 
PF00478; IMP dehydrogenase / GMP reductase domain.
FT 101 160 
PS50953; KID.
FT 113 153 
PF02173; pKID domain.
FT 281 339 
SM00338; brlzneu.
FT 281 341 
PF00170; bZIP transcription factor.
FT 282 284 
AAR, critical for interaction with tax [15].
FT 283 334 
PS50217; BZIP.
XX
SF multiple splice variants [24];
SF leucine zipper-independent binding of the coactivator CBP [7];
SF the Tax activator of HTLV-I interacts with the basic region [28] [29];
SF decreasing the dissociation constant for CREB-A homodimers (from 7 nM to 0.1 nM) and for (CREB-A)2-DNA complexes (from 60 nM to 14.4 nM) [26];
SF and altering the DNA binding selectivity [28];
SF the activity of Q2 is mediated by direct interaction with the TAF-110 component of TFIID [16];
XX
CP spleen, heart, thymus, lymphocytes, gut, brain, kidney; very weak expression in testis and liver.
XX
FF activator;
FF mediates cAMP-response after phosphorylation at Ser-133 by PKA within the kinase-inducible domain (KID) [22];
FF KID cooperates with Q2 domain in transcriptional stimulation;
FF Q2 interacts with the TAF-110 component of TFIID [16];
FF dephosphorylation may be by nuclear protein phosphatase 2A (PP2A) [6];
FF Ser-133 phosphorylation is also achieved in response to a calcium / diacylglycerol-dependent pathway [30];
FF for trans-activation by CREB-A, association with CBP is required which is triggered by cAMP, but not by a calcium / diacylglycerol-dependent pathway [30];
FF significant enhancement of dimerization by Tax [18] [21];
FF may also inhibit activity of some unrelated factors [11];
FF altered DNA-binding specificity after complexing with pX [19];
FF involved in the regulation of catecholamine biosynthesis including cAMP dependent regulation of DBH (dopamine beta-hydroxylase) and TH (tyrosine hydroxylase) [31] [33] [34];
FF important regulator of MHC class II expression, known as X2BP, cooperate with RFX and NF-Y [10] [35] [36];
FF cooperates with CIITA T05450 to activate MHC class II gene expression [39];
XX
IN T00968 ATF-1; human, Homo sapiens.
IN T01304 ATF-1; mouse, Mus musculus.
IN T00051 ATF; human, Homo sapiens.
IN T02214 CBP-isoform1; human, Homo sapiens.
IN T01305 CBP100; mouse, Mus musculus.
IN T01318 CBP; mouse, Mus musculus.
IN T15118 CBP; Mammalia.
IN T00163 CREB-A; human, Homo sapiens.
IN T00166 CREB-B; human, Homo sapiens.
IN T01314 CREMalpha; mouse, Mus musculus.
IN T00165 deltaCREB; rat, Rattus norvegicus.
IN T01311 deltaCREB; mouse, Mus musculus.
IN T01381 deltaCREB; mink, Mustela vison.
IN T01319 ICER; rat, Rattus norvegicus.
IN T01427 p300; human, Homo sapiens.
IN T01384 pX; HBV, human hepatitis B virus.
IN T00793 Tax; HTLV-I, human T-cell lymphotropic virus type I.
IN T08239 TORC1; human, Homo sapiens.
IN T08240 TORC2; human, Homo sapiens.
XX
MX M07248 V$CREB1_Q3.
MX M03544 V$CREB1_Q6.
MX M00981 V$CREBATF_Q6.
MX M00039 V$CREB_01.
MX M00113 V$CREB_02.
MX M00177 V$CREB_Q2.
MX M00916 V$CREB_Q2_01.
MX M00801 V$CREB_Q3.
MX M00178 V$CREB_Q4.
MX M00917 V$CREB_Q4_01.
MX M00114 V$TAXCREB_01.
MX M00115 V$TAXCREB_02.
XX
BS R00322.
BS R00343.
BS R00356.
BS R00362.
BS R00366.
BS R00309.
BS R16162.
BS R04240.
BS R04241.
BS R04242.
BS R04110.
BS R04577.
BS R04045.
BS R02906.
BS R14826.
BS R08102.
BS R12540.
BS R25053.
BS R04501.
BS R16066.
BS R04356.
BS R09519.
BS R16774.
BS R16776.
BS R00454.
BS R00455.
BS R00456.
BS R00471.
BS R00592.
BS R61719.
BS R12331.
BS R02710.
BS R21737.
BS R14781.
BS R03105.
BS R03104.
BS R12102.
BS R03694.
BS R13373.
BS R19934.
BS R15485.
BS R16161.
BS R03738.
BS R04963.
BS R01508.
BS R17209.
BS R31325.
BS R14791.
BS R14792.
BS R04029.
BS R16061.
BS R01559.
BS R00777.
BS R00779.
BS R00780.
BS R19112.
BS R31321.
BS R00479.
BS R74094.
BS R08487.
BS R00963.
BS R01053.
BS R01062.
BS R31316.
BS R04882.
BS R13230.
BS R02378.
BS R22891.
BS R01215.
BS R01358.
BS R09520.
BS R04884.
BS R04578.
BS R04579.
XX
DR TRANSPATH: MO000019480.
DR TRANSCOMPEL: C00087.
DR TRANSCOMPEL: C00088.
DR TRANSCOMPEL: C00106.
DR TRANSCOMPEL: C00197.
DR TRANSCOMPEL: C00379.
DR TRANSCOMPEL: C00382.
DR TRANSCOMPEL: C00383.
DR TRANSCOMPEL: C00392.
DR EMBL: M27691;
DR EMBL: M34356;
DR EMBL: S72459;
DR EMBL: X55545;
DR EMBL: X60003;
DR EMBL: X68994; HSCREBGNA.
DR UniProtKB: P16220-1;
XX
RN [1]; RE0000620.
RX PUBMED: 2850259.
RA Weller P., Bark C., Janson L., Pettersson U.
RT Transcription analysis of a human U4C gene: involvement of transcription factors novel to snRNA gene expression
RL Genes Dev. 2:1389-1399 (1988).
RN [2]; RE0001012.
RX PUBMED: 1847391.
RA Fink J. S., Verhave M., Walton K., Mandel G., Goodman R. H.
RT Cyclic AMP- and phorbol ester-induced transcriptional activation are mediated by the same enhancer element in the human vasoactive intestinal peptide gene
RL J. Biol. Chem. 266:3882-3887 (1991).
RN [3]; RE0001080.
RX PUBMED: 8394325.
RA Quinn P. G.
RT Distinct activation domains within cAMP response element-binding protein (CREB) mediate basal and cAMP-stimulated transcription
RL J. Biol. Chem. 268:16999-17009 (1993).
RN [4]; RE0001247.
RX PUBMED: 2542772.
RA Dean D. C., Blakeley M. S., Newby R. F., Ghazal P., Hennighausen L., Bourgeois S.
RT Forskolin Inducibility and Tissue-Specific Expression of the Fibronectin Promoter
RL Mol. Cell. Biol. 9:1498-1506 (1989).
RN [5]; RE0001461.
RX PUBMED: 2147221.
RA Hurst H. C., Masson M., Jones N. C., Lee K. A. W.
RT The cellular transcription factor CREB corresponds to activating transcription factor 47 (ATF-47) and forms complexes with a group of polypeptides related to ATF-43
RL Mol. Cell. Biol. 10:6192-6203 (1990).
RN [6]; RE0001735.
RX PUBMED: 8386317.
RA Wadzinski B. E., Wheat W. H., Jaspers S., Peruski jr L. F., Lickteig R. L., Johnson G. L., Klemm D. J.
RT Nuclear protein phosphatase 2A dephosphorylates protein kinase A-phosphorylated CREB and regulates CREB transcriptional stimulation
RL Mol. Cell. Biol. 13:2822-2834 (1993).
RN [7]; RE0001914.
RX PUBMED: 8413673.
RA Chrivia J. C., Kwok R. P. S., Lamb N., Hagiwara M., Montminy M. R., Goodman R. H.
RT Phosphorylated CREB binds specifically to the nuclear protein CBP
RL Nature 365:855-859 (1993).
RN [8]; RE0001915.
RX PUBMED: 8397338.
RA Stehle J. H., Foulkes N. S., Molina C. A., Simonneaux V., Pevet P., Sassone-Corsi P.
RT Adrenergic signals direct rhythmic expression of transcriptional repressor CREM in the pineal gland
RL Nature 365:314-320 (1993).
RN [9]; RE0001971.
RX PUBMED: 2959908.
RA Garcia J., Wu F., Gaynor R.
RT Upstream regulatory regions required to stabilize binding to the TATA sequence in an adenovirus early promoter
RL Nucleic Acids Res. 15:8367-8385 (1987).
RN [10]; RE0002187.
RX PUBMED: 1956787.
RA Hasegawa S. L., Boss J. M.
RT Two B cell factors bind the HLA-DRA X box region and recognize different subsets of HLA class II promoters
RL Nucleic Acids Res. 19:6269-6276 (1991).
RN [11]; RE0002228.
RX PUBMED: 8332500.
RA Lemaigre F. P., Ace C. I., Green M. R.
RT The cAMP response element binding protein, CREB, is a potent inhibitor of diverse transcriptional activators
RL Nucleic Acids Res. 21:2907-2911 (1993).
RN [12]; RE0002276.
RX PUBMED: 2837758.
RA Hardy S., Shenk T.
RT Adenoviral control regions activated by E1A and the cAMP responsive element bind to the same factor
RL Proc. Natl. Acad. Sci. USA 85:4171-4175 (1988).
RN [13]; RE0002352.
RX PUBMED: 2842787.
RA Fink J. S., Verhave M., Kasper S., Tsukada T., Mandel G., Goodman R. H.
RT The CGTCA sequence motif is essential for biological activity of the vasoactive intestinal peptide gene cAMP-regulated enhancer
RL Proc. Natl. Acad. Sci. USA 85:6662-6666 (1988).
RN [14]; RE0002506.
RX PUBMED: 2142528.
RA Berkowitz L. A., Gilman M. Z.
RT Two distinct forms of active transcription factor CREB (cAMP response element binding protein)
RL Proc. Natl. Acad. Sci. USA 87:5258-5262 (1990).
RN [15]; RE0002562.
RX PUBMED: 8202541.
RA Adya N., Zhao L.-J., Huang W., Boros I., Giam C.-Z.
RT Expansion of CREB's DNA recognition specificity by Tax results from interaction with Ala-Ala-Arg at positions 282-284 near the conserved DNA-binding domain of CREB
RL Proc. Natl. Acad. Sci. USA 91:5642-5646 (1994).
RN [16]; RE0002564.
RX PUBMED: 7906413.
RA Ferreri K., Gill G., Montminy M.
RT The cAMP-regulated transcription factor CREB interacts with a component of the TFIID complex
RL Proc. Natl. Acad. Sci. USA 91:1210-1213 (1994).
RN [17]; RE0002638.
RX PUBMED: 2974179.
RA Hoeffler J. P., Meyer T. E., Yun Y., Jameson J. L., Habener J. F.
RT Cyclic AMP-responsive DNA-binding protein: structure based on a cloned placental cDNA
RL Science 242:1430-1433 (1988).
RN [18]; RE0002710.
RX PUBMED: 8211160.
RA Wagner S., Green M. R.
RT HTLV-I Tax protein stimulation of DNA binding of bZIP proteins by enhancing dimerization
RL Science 262:395-399 (1993).
RN [19]; RE0002717.
RX PUBMED: 1827531.
RA Maguire H. F., Hoeffler J. P., Siddiqui A.
RT HBV X protein alters the DNA binding specificity of CREB and ATF-2 by protein-protein interactions
RL Science 252:842-844 (1991).
RN [20]; RE0003157.
RX PUBMED: 2196176.
RA Yoshimura T., Fujisawa J.-I., Yoshida M.
RT Multiple cDNA clones encoding nuclear proteins that bind to the tax-dependent enhancer of HTLV-1: all contain a leucine zipper structure and basic amino acid domain
RL EMBO J. 9:2537-2542 (1990).
RN [21]; RE0005237.
RX PUBMED: 8421695.
RA Suzuki T.
RT -
RL Proc. Natl. Acad. Sci. USA 90:610-614 (1993).
RN [22]; RE0005238.
RX PUBMED: 2479635.
RA Grove J. R., Deutsch P. J., Price D. J., Habener J. F., Avruch J.
RT Plasmids encoding PKI(1-31), a specific inhibitor of cAMP-stimulated gene expression, inhibit the basal transcriptional activity of some but not all cAMP-regulated DNA response elements in JEG-3 cells
RL J. Biol. Chem. 264:19506-19513 (1989).
RN [23]; RE0005240.
RX PUBMED: 1889088.
RA Jones K. W., Shapero M. H., Chevrette M., Fournier R. E.
RT Subtractive hybridization cloning of a tissue-specific extinguisher: TSE1 encodes a regulatory subunit of protein kinase A.
RL Cell 66:861-872 (1991).
RN [24]; RE0005242.
RX PUBMED: 1723142.
RA Waeber G., Meyer T. E., LeSieur M., Hermann H. L., Gerard N., Habener J. F.
RT Developmental stage specific expression of the cyclic AMP response element binding protein CREB during spermatogenesis involves alternative exon splicing
RL Mol. Endocrinol. 5:1418-1430 (1991).
RN [25]; RE0005244.
RX PUBMED: 8105470.
RA Loriaux M. M., Rehfuss R. R., Brennan R. G., Goodman R. H.
RT Engineered leucine zippers show that hemiphosphorylated CREB complexes are transcritionally active
RL Proc. Natl. Acad. Sci. USA 90:9046-9050 (1993).
RN [26]; RE0005246.
RX PUBMED: 8065935.
RA Anderson M. G., Dynan W. S.
RT Quantitative studies of the effect of HTLV-I Tax protein on CREB protein-DNA binding
RL Nucleic Acids Res. 22:3194-3201 (1994).
RN [27]; RE0005247.
RX PUBMED: 8065321.
RA Wheat W. H., Roesler W. J., Klemm D. J.
RT Simian virus 40 small tumor antigen inhibits dephosphorylation of protein kinase A-phosphorylated CREB and regulates CREB transcriptional stimulation
RL Mol. Cell. Biol. 14:5881-5890 (1994).
RN [28]; RE0005255.
RX PUBMED: 7637811.
RA Perini G., Wagner S., Green M. R.
RT Recognition of bZIP proteins by the human T-cell leukemia virus transactivator Tax
RL Nature 376:602-605 (1995).
RN [29]; RE0005256.
RX PUBMED: 7637812.
RA Baranger A. M., Palmer C. R., Hamm M. K., Giebler H. A., Brauweiler A., Nyborg J. K., Schepartz A.
RT Mechanism of DNA-binding enhancement by the human T-cell leukaemia virus transcativator Tax
RL Nature 376:606-608 (1995).
RN [30]; RE0006681.
RX PUBMED: 7479832.
RA Brindle P., Nakajima T., Montminy M.
RT Multpile protein kinase A-regulated events are required for transcriptional induction by cAMP
RL Proc. Natl. Acad. Sci. USA 92:10521-10525 (1995).
RN [31]; RE0015224.
RX PUBMED: 9341190.
RA Swanson D. J., Zellmer E., Lewis E. J.
RT The homeodomain protein Arix interacts synergistically with cyclic AMP to regulate expression of neurotransmitter biosynthetic genes
RL J. Biol. Chem. 272:27382-27392 (1997).
RN [32]; RE0015247.
RX PUBMED: 8380196.
RA Lamouroux A., Houhou L., Biguet N. F., Serck-Hanssen G., Guibert B., Icard-Liepkalns C., Mallet J.
RT Analysis of the human dopamine beta-hydroxylase promoter: transcriptional induction by cyclic AMP
RL J. Neurochem 60:364-367 (1993).
RN [33]; RE0015252.
RX PUBMED: 10644760.
RA Swanson D. J., Adachi M., Lewis E. J.
RT The homeodomain protein Arix promotes protein kinase A-dependent activation of the dopamine beta-hydroxylase promoter through multiple elements and interaction with the coactivator cAMP-response element-binding protein-binding protein
RL J. Biol. Chem. 275:2911-2923 (2000).
RN [34]; RE0015255.
RX PUBMED: 8753872.
RA Seo H., Yang C., Kim H. S., Kim K. S.
RT Multiple protein factors interact with the cis-regulatory elements of the proximal promoter in a cell-specific manner and regulate transcription of the dopamine beta-hydroxylase gene
RL J. Neurosci. 16:4102-4112 (1996).
RN [35]; RE0016589.
RX PUBMED: 9378978.
RA Louis-Plence P., Moreno C. S., Boss J. M.
RT Formation of a Regulatory Factor X/X2 box-binding protein/Nuclear Factor-Y multiprotein complex on the conserved regulatory regions of HLA Class II genes.
RL J. Immunol. 159:3899-3909 (1997).
RN [36]; RE0016633.
RX PUBMED: 8051086.
RA Reith W., Korb M., Emery P., Durand B., Siegrist C.-A., Mach B.
RT Cooperative binding between factors RFX and X2bp to the X and X2 boxes of MHC Class II promoters.
RL J. Biol. Chem. 269:20020-20025 (1994).
RN [37]; RE0020179.
RX PUBMED: 1831258.
RA SHORT M.L., MANOHAR C.F., FURTADO M.R., GHADGE G.D., WOLINSKY S.M., THIMMAPAYA B., JUNGMANN R.A.
RT Nucleotide and derived amino-acid sequences of the CRE-binding proteins from rat C6 glioma and HeLa cells.
RL Nucleic Acids Res. 19:4290-4290 (1991).
RN [38]; RE0020180.
RX PUBMED: 1966745.
RA WAEBER G., MEYER T.E., HOEFFLER J.P., HABENER J.F.
RT Diversification of cyclic AMP-responsive enhancer binding proteins-generated by alternative exon splicing.
RL Trans. Assoc. Am. Physicians 103:28-37 (1990).
RN [39]; RE0022543.
RX PUBMED: 10072067.
RA Moreno C. S., Beresford G. W., Louis-Plence P., Morris A. C., Boss J. M.
RT CREB regulates MHC class II expression in a CIITA-dependent manner.
RL Immunity 10:143-151 (1999).
RN [40]; RE0033960.
RX PUBMED: 15078890.
RA Nishihara H., Hwang M., Kizaka-Kondoh S., Eckmann L., Insel P. A.
RT Cyclic AMP promotes cAMP-responsive element-binding protein-dependent induction of cellular inhibitor of apoptosis protein-2 and suppresses apoptosis of colon cancer cells through ERK1/2 and p38 MAPK.
RL J. Biol. Chem. 279:26176-83 (2004).
RN [41]; RE0035135.
RX PUBMED: 15082775.
RA Euskirchen G., Royce T. E., Bertone P., Martone R., Rinn J. L., Nelson F. K., Sayward F., Luscombe N. M., Miller P., Gerstein M., Weissman S., Snyder M.
RT CREB binds to multiple loci on human chromosome 22.
RL Mol. Cell. Biol. 24:3804-3814 (2004).
RN [42]; RE0049918.
RX PUBMED: 16293623.
RA Dodson G. E., Tibbetts R. S.
RT DNA replication stress-induced phosphorylation of cyclic AMP response element-binding protein mediated by ATM.
RL J. Biol. Chem. 281:1692-1697 (2006).
RN [43]; RE0049979.
RX PUBMED: 15073328.
RA Shi Y., Venkataraman S. L., Dodson G. E., Mabb A. M., LeBlanc S., Tibbetts R. S.
RT Direct regulation of CREB transcriptional activity by ATM in response to genotoxic stress.
RL Proc. Natl. Acad. Sci. USA 101:5898-5903 (2004).
RN [44]; RE0070919.
RX PUBMED: 20573984.
RA Sakamoto K., Huang B. W., Iwasaki K., Hailemariam K., Ninomiya-Tsuji J., Tsuji Y.
RT Regulation of genotoxic stress response by homeodomain-interacting protein kinase 2 through phosphorylation of cyclic AMP response element-binding protein at serine 271.
RL Mol. Biol. Cell 21:2966-2974 (2010).
XX
//