TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01314 XX ID T01314 XX DT 23.10.1994 (created); ewi. DT 16.07.2012 (updated); mkl. CO Copyright (C), QIAGEN. XX FA CREMalpha XX SY cAMP responsive element modulator; CREM; CREM-alpha. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G000532 Crem. XX CL C0008; bZIP. XX SZ 245 AA; 27.5 kDa (cDNA) (calc.). XX SQ MSKCGRKKYMRTNVRQMTMETVESQQDRSVTRSVAEHSSAHMQTGQISVPTLAQVATIAE SQ TDDSADSEVIDSHKRREILSRRPSYRKILNELSSDVPGIPKIEEEKSEEEGTPPNIATMA SQ VPTSIYQTSTGQYNEETDLAPSHMAAATGDMPTYQIRAPTTALPQGVVMAASPGSLHSPQ SQ QLAEEATRKRELRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLY SQ CHKAE XX SC Swiss-Prot#P27699-2 XX FT 36 95 PS50953; KID. FT 48 88 PF02173; pKID domain. FT 117 176 kinase-inducible modulating domain (KID) [3]. FT 169 227 SM00338; brlzneu. FT 169 229 PF00170; bZIP transcription factor. FT 171 222 PS50217; BZIP. XX SF encoded by crem exons 1 (B), 3 (E), 4 (F), 6 (X), 7 (H), and the 5'-half of exon 8 (Ia) [9]; SF several alternative splice variants including some with an alternative DNA-binding domain [1]; SF very similar if not identical DNA-binding specificity as CREB [1]; SF homo- and heterodimeric DNA-binding with CREB [1]; XX CP mRNA: adult brain: inner layer of cerebral cortex, anterior thalamus, hippocampus, hypothalamus [8], pituitary gland; kidney, heart; very low levels in testis [2] [2] [8]. XX FF repressor, CREB antagonist as dominant negative regulator [1] [6]; FF may confer cAMP/PKA-dependent effects, even stimulatory ones, onto other factors bound in the vicinity of CREMalpha [3]; FF CREMalpha is upregulated in CREB -/- mice; FF use of an alternative polyadenylation site in the testis of FSH-treated rodents leads to a transcript with enhanced stability [7]; FF osmotic stimulation of the supraoptic nucleus, induction of CREMalpha (and -beta) correlates with down-regulation of c-fos [8]; XX IN T00163 CREB-A; human, Homo sapiens. IN T00164 CREB1; rat, Rattus norvegicus. IN T01385 CREB1; cattle, Bos taurus. IN T00989 CREB; mouse, Mus musculus. IN T01127 CREB; pig, Sus scrofa. IN T01307 CREB; hamster, Cricetulus sp. IN T01380 CREB; mink, Mustela vison. IN T01314 CREMalpha; mouse, Mus musculus. IN T01319 ICER; rat, Rattus norvegicus. XX MX M00981 V$CREBATF_Q6. MX M00916 V$CREB_Q2_01. MX M00801 V$CREB_Q3. MX M00917 V$CREB_Q4_01. MX M01820 V$CREM_Q6. MX M08803 V$CREM_Q6_01. XX BS R15129. BS R14617. BS R01358. XX DR TRANSPATH: MO000025575. DR EMBL: M60285; DR UniProtKB: P27699-2; XX RN [1]; RE0000262. RX PUBMED: 1847666. RA Foulkes N. S., Borrelli E., Sassone-Corsi P. RT CREM gene: use of alternative DNA-binding domains generates multiple antagonists of cAMP-induced transcription RL Cell 64:739-749 (1991). RN [2]; RE0001912. RX PUBMED: 1370576. RA Foulkes N. S., Mellstroem B., Benusiglio E., Sassone-Corsi P. RT Developmental switch of CREM function during spermatogenesis: from antagonist to activator RL Nature 355:80-84 (1992). RN [3]; RE0001913. RX PUBMED: 8102791. RA Brindle P., Linke S., Montminy M. RT Protein-kinase-A-dependent activator in transcription factor CREB reveals new role for CREM repressors RL Nature 364:821-824 (1993). RN [4]; RE0001915. RX PUBMED: 8397338. RA Stehle J. H., Foulkes N. S., Molina C. A., Simonneaux V., Pevet P., Sassone-Corsi P. RT Adrenergic signals direct rhythmic expression of transcriptional repressor CREM in the pineal gland RL Nature 365:314-320 (1993). RN [5]; RE0002563. RX PUBMED: 8202542. RA Hummler E., Cole T. J., Blendy J. A., Ganss R., Aguzzi A., Schmid W., Beermann F., Schuetz G. RT Targeted mutation of the CREB gene: compensation within the CREB/ATF family of transcription factors RL Proc. Natl. Acad. Sci. USA 91:5647-5651 (1994). RN [6]; RE0003158. RX PUBMED: 8458330. RA Laoide B.M., Foulkes N.S., Schlotter F., Sassone-Corsi P. RT The functional versatility of CREM is determined by its modular structure RL EMBO J. 12:1179-1191 (1993). RN [7]; RE0005265. RX PUBMED: 7681549. RA Foulkes N. S., Schlotter F., Pevet P., Sassone-Corsi P. RT Pituitary hormone FSH directs the CREM functional switch during spermatogenesis RL Nature 362:264-267 (1993). RN [8]; RE0005266. RX PUBMED: 8386526. RA Mellstroem B., Naranjo J. R., Foulkes N. S., Lafarga M., Sassone-Corsi P. RT Transcriptional response to cAMP in brain: specific distribution and induction of CREM antagonists RL Neuron 10:655-665 (1993). RN [9]; RE0000312. RX PUBMED: 3023048. RA Moncollin V., Miyamoto N. G., Zheng X. M., Egly J. M. RT Identification of a factor specific for the upstream element of the adenovirus-2 major late promoter RL EMBO J. 5:2577-2584 (1986). XX //