
AC T00164
XX
ID T00164
XX
DT 15.10.1992 (created); ewi.
DT 30.08.2013 (updated); uat.
CO Copyright (C), QIAGEN.
XX
FA CREB1
XX
SY ATF-47 (human); cAMP-response element binding protein; CREB; CREB-1; CREB-341; CREB-B; CREB1; CREBalpha; Cyclic AMP Responsive Element Binging factor.
XX
OS rat, Rattus norvegicus
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae
XX
GE G009126 Creb1.
XX
CL C0008; bZIP; 1.1.7.1.1.1.
XX
SZ 341 AA; 36.6 kDa (cDNA) (calc.), 43 kDa (SDS)
XX
SQ MTMDSGADNQQSGDAAVTEAESQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
SQ GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQ SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
SQ QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
SQ VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
SQ RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
XX
SC Swiss-Prot#P15337-1
XX
FT 23 338
PF00478; IMP dehydrogenase / GMP reductase domain.
FT 41 86
basal activation domain [11].
FT 101 160
PS50953; KID.
FT 113 153
PF02173; pKID domain.
FT 165 252
basal activation domain [11].
FT 281 339
SM00338; brlzneu.
FT 281 341
PF00170; bZIP transcription factor.
FT 282 284
AAR, critical for interaction with Tax [25].
FT 283 334
PS50217; BZIP.
XX
SF multiple splice variants [8] [38];
SF pI (cal.)=5.7-6.0 [7];
SF leucine zipper-independent binding of coactivator CBP [19];
SF interaction with CBP is not inhibited by introducing a negative charge in position 142 (serine phosphorylation or Asp-substitution) [46];
SF the Tax activator of HTLV-I interacts with the basic region decreasing the dissociation constant for CREB11 homodimers (from 7 nM to 0.1 nM) and for (CREB11)2-DNA complexes (from 60 nM to 14.4 nM) and altering the DNA binding selectivity [41] [45];
SF Q1, Q2 and DLSSD motifs are required for full basal and induced transcription activation [11] [12];
SF the activity of Q2 is repressed by KID (kinase-induced domain) unless KID is phosphorylated at Ser-133 [11] [3] [27];
SF deletion of KID enhances both basal and induced transcription [11];
SF the amphiphilic alpha-helical alpha domain is thought to augment the activation process [1];
SF dephosphorylation may be achieved by the nuclear phosphatase PP1 [33];
SF cAMP activation of rat NAT (serotonin N-acetyltransferase) requires a CRE-CCAAT complex consisting of a CRE an inverted CCAAT box located within two helical turns [47];
XX
CP spleen, heart, thymus, gut, brain, kidney; very weak expression in testis and liver; constitutively expressed in preadipocytes and throughout the differentiation process [53].
XX
FF activation of CREB11 was necessary to induce adipogenesis [53];
FF activation is stimulated by insulin, dexamethasone, and dibutyryl cAMP [53];
FF cAMP-dependent phosphorylation by PKA leads to induction of trans-activation [34] [36] [15];
FF PKA regulatory subunit RIalpha is encoded by the tissue-specific extinguisher locus, Tse1, which mediates deactivation of CREB11 [4];
FF also phosphorylation of Ser-133 by CaM kinases I, II, and IV in vitro and after membrane depolarization in PC12 cells [28] [42] [29];
FF CamK II also phosphorylates Ser-142 which counteracts the activating phosphorylation at Ser-133 [42] [43];
FF similarly, replacing Ser-142 by Asp nearly abolishes the inducibility of CREB11 by PKA [46];
FF light exposure triggers Ser-133 phosphorylation within suprachiasmatic nuclei in the hypothalamus controlling the circadian rhythm [30];
FF phosphorylation-dependent change in genomic binding status is observed at asymmetric, low-affinity sites only [6];
FF if not phosphorylated, CREB11 may act as a repressor [27];
FF mediates NO-amplified calcium-induced transcription [18];
FF significant enhancement of dimerization by Tax;
FF may also inhibit activity of some unrelated factors [23];
FF splice variant: deltaCREB11;
FF testis-specific splice product with multiple stop codons within its alternative exon;
FF in glioma cells, transcription of the CREB11 gene is induced by glucocorticoids [32];
FF CREB11 may synergize with Isl-1 T01035 rendering activation independent of CREB11 phosphorylation [24];
FF involved in the cAMP dependent regulation of catecholamine neurotransmitter biosynthesis [48];
FF light-dependent phosphorylation of CREB11 in the suprachiasmatic nucleus [50];
XX
IN T00968 ATF-1; human, Homo sapiens.
IN T01304 ATF-1; mouse, Mus musculus.
IN T00051 ATF; human, Homo sapiens.
IN T01305 CBP100; mouse, Mus musculus.
IN T00166 CREB-B; human, Homo sapiens.
IN T00164 CREB1; rat, Rattus norvegicus.
IN T01314 CREMalpha; mouse, Mus musculus.
IN T01600 CREMdeltaC-G; rat, Rattus norvegicus.
IN T00165 deltaCREB; rat, Rattus norvegicus.
IN T01311 deltaCREB; mouse, Mus musculus.
IN T01381 deltaCREB; mink, Mustela vison.
IN T01319 ICER; rat, Rattus norvegicus.
IN T01384 pX; HBV, human hepatitis B virus.
IN T00793 Tax; HTLV-I, human T-cell lymphotropic virus type I.
XX
MX M07248 V$CREB1_Q3.
MX M03544 V$CREB1_Q6.
MX M00981 V$CREBATF_Q6.
MX M00039 V$CREB_01.
MX M00113 V$CREB_02.
MX M00177 V$CREB_Q2.
MX M00916 V$CREB_Q2_01.
MX M00801 V$CREB_Q3.
MX M00178 V$CREB_Q4.
MX M00917 V$CREB_Q4_01.
MX M00114 V$TAXCREB_01.
MX M00115 V$TAXCREB_02.
XX
BS R00322.
BS R00362.
BS R01196.
BS R04110.
BS R04577.
BS R00288.
BS R00471.
BS R00592.
BS R08084.
BS R01256.
BS R03738.
BS R04029.
BS R16131.
BS R01559.
BS R00777.
BS R00779.
BS R04032.
BS R00963.
BS R57746.
BS R14606.
BS R14607.
BS R16168.
BS R04882.
BS R09065.
BS R16154.
BS R18498.
BS R18511.
BS R14820.
BS R74089.
BS R73980.
BS R09471.
BS R16447.
BS R02456.
BS R04876.
BS R01217.
BS R01358.
BS R03401.
BS R73927.
BS R04884.
BS R04578.
BS R04579.
XX
DR TRANSPATH: MO000003369.
DR TRANSCOMPEL: C00129.
DR TRANSCOMPEL: C00225.
DR TRANSCOMPEL: C00369.
DR EMBL: X14788;
DR EMBL: X60002;
DR UniProtKB: P15337-1;
XX
RN [1]; RE0000233.
RX PUBMED: 2137373.
RA Yamamoto K. K., Gonzalez G. A., Menzel P., Rivier J., Montminy M. R.
RT Characterization of a bipartite activator domain in transcription factor CREB
RL Cell 60:611-617 (1990).
RN [2]; RE0000262.
RX PUBMED: 1847666.
RA Foulkes N. S., Borrelli E., Sassone-Corsi P.
RT CREM gene: use of alternative DNA-binding domains generates multiple antagonists of cAMP-induced transcription
RL Cell 64:739-749 (1991).
RN [3]; RE0000275.
RX PUBMED: 2573431.
RA Gonzalez G. A., Montminy M. R.
RT Cyclic AMP stimulates somatostatin gene transcription by phosphorylation of CREB at serine 133
RL Cell 59:675-680 (1989).
RN [4]; RE0000276.
RX PUBMED: 1971524.
RA Boshart M., Weih F., Schmidt A., Fournier R. E. K., Schuetz G.
RT A cyclic AMP response element mediates repression of tyrosine aminotransferase gene transcription by the tissue-specific extinguisher locus Tse-1
RL Cell 61:905-916 (1990).
RN [5]; RE0000277.
RX PUBMED: 1832337.
RA Boshart M., Weih F., Nichols M., Schuetz G.
RT The tissue-specific extinguisher locus TSE1 encodes a regulatory subunit of cAMP-dependent protein kinase
RL Cell 66:849-859 (1991).
RN [6]; RE0000552.
RX PUBMED: 1354612.
RA Nichols M., Weih F., Schmid W., DeVack C., Kowenz-Leutz E., Luckow B., Boshart M., Schuetz G.
RT Phosphorylation of CREB affects its binding to high and low affinity sites: implications for cAMP induced gene transcription
RL EMBO J. 11:3337-3346 (1992).
RN [7]; RE0000559.
RX PUBMED: 1850693.
RA Kramer I. M., Koornneef I., de Laat S. W., van den Eijnden-van Raaij A. J. M.
RT TGF-beta1 induces phosphorylation of the cyclic AMP responsive element binding protein in ML-CCI64 cells
RL EMBO J. 10:1083-1089 (1991).
RN [8]; RE0000564.
RX PUBMED: 1396344.
RA Waeber G., Habener J. F.
RT Novel testis germ cell-specific transcript of the CREB gene contains an alternatively spliced exon with multiple in-frame stop codons
RL Endocrinology 131:2010-2015 (1992).
RN [9]; RE0000796.
RX PUBMED: 1977662.
RA Weih F., Stewart A. F., Boshart M., Nitsch D., Schuetz G.
RT In vivo monitoring of a cAMP-stimulated DNA-binding activity
RL Genes Dev. 4:1437-1449 (1990).
RN [10]; RE0000841.
RX PUBMED: 2461942.
RA Bokar J. A., Roesler W. J., Vandenbark G. R., Kaetzel D. M., Hanson R. W., Nilson J. H.
RT Characterization of the cAMP Responsive Elements from the Genes for the alpha-Subunit of Glycoprotein Hormones and Phosphoenolpyruvate Carboxykinase (GTP)
RL J. Biol. Chem. 263:19740-19747 (1988).
RN [11]; RE0001080.
RX PUBMED: 8394325.
RA Quinn P. G.
RT Distinct activation domains within cAMP response element-binding protein (CREB) mediate basal and cAMP-stimulated transcription
RL J. Biol. Chem. 268:16999-17009 (1993).
RN [12]; RE0001597.
RX PUBMED: 1671708.
RA Gonzalez G. A., Menzel P., Leonard J., Fisher W. H., Montminy M. R.
RT Characterization of motifs which are critical for activity of the cyclic AMP-responsive transcription factor CREB
RL Mol. Cell. Biol. 11:1306-1312 (1991).
RN [13]; RE0001639.
RX PUBMED: 2141384.
RA Quinn P. G., Granner D. K.
RT Cyclic AMP-dependent protein kinase regulates transcription of the phosphoenolpyruvate carboxykinase gene but not binding of nuclear factors to the cyclic AMP regulatory element
RL Mol. Cell. Biol. 10:3357-3364 (1990).
RN [14]; RE0001737.
RX PUBMED: 8413297.
RA Miller C. P., Lin J. C., Habener J. F.
RT Transcription of the rat glucagon gene by the cyclic AMP response element-binding protein CREB is modulated by adjacent CREB-associated proteins
RL Mol. Cell. Biol. 13:7080-7090 (1993).
RN [15]; RE0001781.
RX PUBMED: 2900470.
RA Yamamoto K. K., Gonzalez G. A., Biggs III W. H., Montminy M. R.
RT Phosphorylation-induced binding and transcriptional efficacy of nuclear factor CREB
RL Nature 334:494-498 (1988).
RN [16]; RE0001821.
RX PUBMED: 2885756.
RA Montminy M. R., Bilezikjian L. M.
RT Binding of a nuclear protein to the cyclic-AMP response element of the somatostatin gene
RL Nature 328:175-178 (1987).
RN [17]; RE0001822.
RX PUBMED: 2521922.
RA Gonzalez G. A., Yamamoto K. K., Fischer W. H., Karr D., Menzel P., Biggs III W., Vale W. W., Montminy M. R.
RT A cluster of phosphorylation sites on the cyclic AMP-regulated nuclear factor CREB predicted by its sequence
RL Nature 337:749-752 (1989).
RN [18]; RE0001910.
RX PUBMED: 8392663.
RA Peunova N., Enikolopov G.
RT Amplification of calcium-induced gene transcription by nitric oxide in neuronal cells
RL Nature 364:450-452 (1993).
RN [19]; RE0001914.
RX PUBMED: 8413673.
RA Chrivia J. C., Kwok R. P. S., Lamb N., Hagiwara M., Montminy M. R., Goodman R. H.
RT Phosphorylated CREB binds specifically to the nuclear protein CBP
RL Nature 365:855-859 (1993).
RN [20]; RE0001915.
RX PUBMED: 8397338.
RA Stehle J. H., Foulkes N. S., Molina C. A., Simonneaux V., Pevet P., Sassone-Corsi P.
RT Adrenergic signals direct rhythmic expression of transcriptional repressor CREM in the pineal gland
RL Nature 365:314-320 (1993).
RN [21]; RE0001925.
RX PUBMED: 2141668.
RA Dash P. K., Hochner B., Kandel E. R.
RT Injection of the cAMP-responsive element into the nucleus of Aplysia sensory neurons blocks long-term facilitation
RL Nature 345:719-721 (1990).
RN [22]; RE0002024.
RX PUBMED: 2537960.
RA Kanei-Ishii C., Ishii S.
RT Dual enhancer activities of the cyclic-AMP responsive element with cell type and promoter specificity
RL Nucleic Acids Res. 17:1521-1536 (1989).
RN [23]; RE0002228.
RX PUBMED: 8332500.
RA Lemaigre F. P., Ace C. I., Green M. R.
RT The cAMP response element binding protein, CREB, is a potent inhibitor of diverse transcriptional activators
RL Nucleic Acids Res. 21:2907-2911 (1993).
RN [24]; RE0002558.
RX PUBMED: 1352885.
RA Leonard J., Serup P., Gonzalez G., Edlund T., Montminy M.
RT The LIM family transcription factor Isl-1 requires cAMP response element binding protein to promote somatostatin expression in pancreatic islet cells
RL Proc. Natl. Acad. Sci. USA 89:6247-6251 (1992).
RN [25]; RE0002562.
RX PUBMED: 8202541.
RA Adya N., Zhao L.-J., Huang W., Boros I., Giam C.-Z.
RT Expansion of CREB's DNA recognition specificity by Tax results from interaction with Ala-Ala-Arg at positions 282-284 near the conserved DNA-binding domain of CREB
RL Proc. Natl. Acad. Sci. USA 91:5642-5646 (1994).
RN [26]; RE0002581.
RX PUBMED: 2875459.
RA Montminy M. R., Sevarino K. A., Wagner J. A., Mandel G., Goodman R. H.
RT Identification of a cyclic-AMP-responsive element within the rat somatostatin gene
RL Proc. Natl. Acad. Sci. USA 83:6682-6686 (1986).
RN [27]; RE0002582.
RX PUBMED: 2140898.
RA Lamph W. W., Dwarki V. J., Ofir R., Montminy M., Verma I. M.
RT Negative and positive regulation by transcription factor cAMP response element-binding protein is modulated by phosphorylation
RL Proc. Natl. Acad. Sci. USA 87:4320-4324 (1990).
RN [28]; RE0002583.
RX PUBMED: 1647024.
RA Dash P. K., Karl K. A., Colicos M. A., Prywes R., Kandel E. R.
RT cAMP response element-binding protein is activated by Ca2+/calmodulin- as well as cAMP-dependent protein kinase
RL Proc. Natl. Acad. Sci. USA 88:5061-5065 (1991).
RN [29]; RE0002647.
RX PUBMED: 1646483.
RA Sheng M., Thompson M. A., Greenberg M. E.
RT CREB: A Ca2+-regulated transcription factor phosphorylated by calmodulin-dependent kinases
RL Science 252:1427-1430 (1991).
RN [30]; RE0002709.
RX PUBMED: 8097062.
RA Ginty D. D., Kornhauser J. M., Thompson M. A., Bading H., Mayo K. E., Takahashi J. S., Greenberg M. E.
RT Regulation of CREB phosphorylation in the suprachiasmatic nucleus by light and a circadian clock
RL Science 260:238-241 (1993).
RN [31]; RE0002710.
RX PUBMED: 8211160.
RA Wagner S., Green M. R.
RT HTLV-I Tax protein stimulation of DNA binding of bZIP proteins by enhancing dimerization
RL Science 262:395-399 (1993).
RN [32]; RE0002833.
RX PUBMED: 1531873.
RA Jungmann R. A.
RT Glucocorticoid induction
RL Nucleic Acids Res. 20:825-829 (1992).
RN [33]; RE0003150.
RX PUBMED: 1352481.
RA Hagiwara M., Alberts A., Brindle P., Meinkoth J., Feramisco J., Deng T., Karin M., Shenolikar S., Montminy M.
RT Transcriptional Attenuation Following cAMP Induction Requires PP-1-Mediated Dephosphorylation of CREB
RL Cell 70:105-113 (1992).
RN [34]; RE0003155.
RX PUBMED: 2847055.
RA Riabowol K.T., Fink J.S., Gilman M.Z., Walsh D.A., Goodman R.H., Feramisco J.R.
RT The catalytic subunit of cAMP-dependent protein kinase induces expression of genes containing cAMP-responsive enhancer elements
RL Nature 336:83-86 (1988).
RN [35]; RE0003158.
RX PUBMED: 8458330.
RA Laoide B.M., Foulkes N.S., Schlotter F., Sassone-Corsi P.
RT The functional versatility of CREM is determined by its modular structure
RL EMBO J. 12:1179-1191 (1993).
RN [36]; RE0005239.
RX PUBMED: 2544878.
RA Mellon P. L., Clegg C. H., Correll L. A., McKnight G. S.
RT Regulation of transcription by cyclic AMP-dependent protein kinase
RL Proc. Natl. Acad. Sci. USA 86:4887-4891 (1989).
RN [37]; RE0005241.
RX PUBMED: 1826763.
RA Struthers R. S., Vale W. W., Arias C., Sawchenko P. E., Montminy M. R.
RT Somatotroph hypoplasia and dwarfism in transgenic mice expressing a non-phosphorylatable CREB mutant
RL Nature 350:622-624 (1991).
RN [38]; RE0005242.
RX PUBMED: 1723142.
RA Waeber G., Meyer T. E., LeSieur M., Hermann H. L., Gerard N., Habener J. F.
RT Developmental stage specific expression of the cyclic AMP response element binding protein CREB during spermatogenesis involves alternative exon splicing
RL Mol. Endocrinol. 5:1418-1430 (1991).
RN [39]; RE0005243.
RX PUBMED: 8336722.
RA Hagiwara M., Brindle P., Harootunian A., Armstrong R., Rivier J., Vale W., Tsien R., Montminy M. R.
RT Coupling of hormonal stimulation and transcription via the cyclic AMP-responsive factor CREB is rate limited by nuclear entry of protein kinase A
RL Mol. Cell. Biol. 13:4852-4859 (1993).
RN [40]; RE0005245.
RX PUBMED: 8506306.
RA Spiro C., Richards J. P., Chandrasekaran S., Brennan R. G., McMurray C. T.
RT Secondary structure creates mismatched base pairs required for high-affinity binding of cAMP response element-binding protein to the human enkephalin enhancer
RL Proc. Natl. Acad. Sci. USA 90:4606-4610 (1993).
RN [41]; RE0005246.
RX PUBMED: 8065935.
RA Anderson M. G., Dynan W. S.
RT Quantitative studies of the effect of HTLV-I Tax protein on CREB protein-DNA binding
RL Nucleic Acids Res. 22:3194-3201 (1994).
RN [42]; RE0005250.
RX PUBMED: 7958915.
RA Sun P., Enslen H., Myung P. S., Maurer R. A.
RT Differential activation of CREB by Ca2+/calmodulin-dependent protein kinases type II and type IV involves phosphorylation of a site that negatively regulates activity
RL Genes Dev. 8:2527-2539 (1994).
RN [43]; RE0005252.
RX PUBMED: 8065343.
RA Matthews R. P., Guthrie C. R., Wailes L. M., Zhao X., Means A. R., McKnight G. S.
RT Calcium/calmodulin-dependent protein kinase types II and IV differentially regulate CREB-dependent gene expression
RL Mol. Cell. Biol. 14:6107-6116 (1994).
RN [44]; RE0005253.
RX PUBMED: 8205620.
RA Ginty D. D., Bonni A., Greenberg M. E.
RT Nerve growth factor activates a Ras-dependent protein kinase that stimulates c-fos transcription via phosphorylation of CREB
RL Cell 77:713-725 (1994).
RN [45]; RE0005255.
RX PUBMED: 7637811.
RA Perini G., Wagner S., Green M. R.
RT Recognition of bZIP proteins by the human T-cell leukemia virus transactivator Tax
RL Nature 376:602-605 (1995).
RN [46]; RE0006685.
RX PUBMED: 7706240.
RA Sun P., Maurer R. A.
RT An inactivating point mutation demonstrates that interaction of cAMP responses element binding protein (CREB) with the CREB binding protein is not sufficient for transcriptional activation
RL J. Biol. Chem. 270:7041-7044 (1995).
RN [47]; RE0014641.
RX PUBMED: 9054387.
RA Baler R., Covington S., Klein D. C.
RT The rat arylalkylamine N-acetyltransferase gene promoter
RL J. Biol. Chem. 272:6979-6985 (1997).
RN [48]; RE0015224.
RX PUBMED: 9341190.
RA Swanson D. J., Zellmer E., Lewis E. J.
RT The homeodomain protein Arix interacts synergistically with cyclic AMP to regulate expression of neurotransmitter biosynthetic genes
RL J. Biol. Chem. 272:27382-27392 (1997).
RN [49]; RE0020179.
RX PUBMED: 1831258.
RA SHORT M.L., MANOHAR C.F., FURTADO M.R., GHADGE G.D., WOLINSKY S.M., THIMMAPAYA B., JUNGMANN R.A.
RT Nucleotide and derived amino-acid sequences of the CRE-binding proteins from rat C6 glioma and HeLa cells.
RL Nucleic Acids Res. 19:4290-4290 (1991).
RN [50]; RE0023881.
RX PUBMED: 12032351.
RA Travnickova-Bendova Z., Cermakian N., Reppert S. M., Sassone-Corsi P.
RT Bimodal regulation of mPeriod promoters by CREB-dependent signaling and CLOCK/BMAL1 activity.
RL Proc. Natl. Acad. Sci. USA 99:7728-7733 (2002).
RN [51]; RE0047599.
RX PUBMED: 11739747.
RA Ko L., Cardona G. R., Henrion-Caude A., Chin W. W.
RT Identification and characterization of a tissue-specific coactivator, GT198, that interacts with the DNA-binding domains of nuclear receptors.
RL Mol. Cell. Biol. 22:357-369 (2002).
RN [52]; RE0051803.
RX PUBMED: 11013247.
RA Wu X., McMurray C. T.
RT Calmodulin kinase II attenuation of gene transcription by preventing cAMP response element-binding protein (CREB) dimerization and binding of the CREB-binding protein.
RL J. Biol. Chem. 276:1735-1741 (2001).
RN [53]; RE0047414.
RX PUBMED: 10629058.
RA Reusch J. E., Colton L. A., Klemm D. J.
RT CREB activation induces adipogenesis in 3T3-L1 cells.
RL Mol. Cell. Biol. 20:1008-1020 (2000).
XX
//