TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01319 XX ID T01319 XX DT 23.10.1994 (created); ewi. DT 05.04.2010 (updated); pro. CO Copyright (C), QIAGEN. XX FA ICER XX SY ICER; inducible cAMP early repressor. XX OS rat, Rattus norvegicus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G009771 Crem. XX CL C0008; bZIP; 1.1.7.1.3.8. XX SZ 120 AA; 13.4 kDa (cDNA) (calc.). XX SQ MAVTGDETDEETDLAPSHMAAATGDMPTYQIRAPTTALPQGVVMAASPGSLHSPQQLAEE SQ ATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTD XX SC SPTREMBL #Q63897 XX FT 60 117 SM00338; brlzneu. FT 60 120 PF00170; bZIP transcription factor. FT 62 113 PS50217; BZIP. XX SF transcript originates from P2 promoter in front of the gamma-domain of other CREM species; XX CP pineal, adrenal, pituitary gland. XX FF cAMP-inducible in R2C cells [2]; FF highly potent repressor of CREB activity; XX IN T00163 CREB-A; human, Homo sapiens. IN T00164 CREB1; rat, Rattus norvegicus. IN T01385 CREB1; cattle, Bos taurus. IN T00989 CREB; mouse, Mus musculus. IN T01127 CREB; pig, Sus scrofa. IN T01307 CREB; hamster, Cricetulus sp. IN T01380 CREB; mink, Mustela vison. IN T01314 CREMalpha; mouse, Mus musculus. IN T01315 CREMbeta; mouse, Mus musculus. IN T01316 CREMgamma; mouse, Mus musculus. IN T01309 CREMtau; mouse, Mus musculus. IN T01602 CREMtaualpha; mouse, Mus musculus. XX MX M00981 V$CREBATF_Q6. MX M00916 V$CREB_Q2_01. MX M00801 V$CREB_Q3. MX M00917 V$CREB_Q4_01. MX M01820 V$CREM_Q6. MX M08803 V$CREM_Q6_01. XX BS R30961. BS R20172. BS R30963. BS R30962. BS R01358. BS R30960. XX DR TRANSPATH: MO000025578. DR EMBL: S66024; DR UniProtKB: Q63897; XX RN [1]; RE0001915. RX PUBMED: 8397338. RA Stehle J. H., Foulkes N. S., Molina C. A., Simonneaux V., Pevet P., Sassone-Corsi P. RT Adrenergic signals direct rhythmic expression of transcriptional repressor CREM in the pineal gland RL Nature 365:314-320 (1993). RN [2]; RE0048825. RX PUBMED: 14656211. RA Morales V., Gonzalez-Robayna I., Hernandez I., Quintana J., Santana P., Ruiz de Galarreta C. M., Fanjul L. F. RT The inducible isoform of CREM (inducible cAMP early repressor, ICER) is a repressor of CYP19 rat ovarian promoter. RL J. Endocrinol. 179:417-425 (2003). XX //