AC T00989
XX
ID T00989
XX
DT 06.12.1993 (created); ewi.
DT 20.02.2014 (updated); pro.
CO Copyright (C), QIAGEN.
XX
FA CREB
XX
SY cAMP-response element binding protein; CRE-like site Binding Protein 36 kDa; CREB; CREB-1; CREB-isoform1; CREB1; CREBalpha; Cyclic AMP Responsive Element Binging factor.
XX
OS mouse, Mus musculus
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae
XX
GE G009769 Creb1.
XX
CL C0008; bZIP; 1.1.7.1.1.1.
XX
SZ 341 AA; 36.7 kDa (cDNA) (calc.).
XX
SQ MTMESGADNQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
SQ GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQ SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
SQ QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
SQ VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
SQ RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
XX
SC Swiss-Prot#Q01147-1
XX
FT 23 338 
PF00478; IMP dehydrogenase / GMP reductase domain.
FT 101 160 
PS50953; KID.
FT 113 153 
PF02173; pKID domain.
FT 281 339 
SM00338; brlzneu.
FT 281 341 
PF00170; bZIP transcription factor.
FT 283 334 
PS50217; BZIP.
XX
SF there are multiple splice variants arising from the CREB gene [1];
SF CREBalpha is the largest and most abundant isoform encoded by exons 2, 4, 5, 7-10a, 11 [1];
SF the coactivator CBP and the negative regulator CBP100 interact with CREB independently of the leucine zipper [5] [13];
SF Q2 is a potent trans-activating region involved in both basal and cAMP-induced transcription [3];
SF the KID (kinase-induced domain) represses the effect of Q2 unless it is phosphorylated at Ser-133 [3];
XX
CP ubiquitous, most abundant in brain [6].
XX
FF strong activator, mediating gene activation in response to cyclic AMP after phosphorylation;
FF normal function is required for long-term memory [11];
FF repression in undifferentiated cells by CBP100 [5];
FF loss of CREB and DeltaCREB may be compensated by enhanced expression of variant CREBbeta T02361 [14];
FF dephosphorylation may take place by a nuclear phosphatase PP1 [12];
FF CREB phosphorylation and interaction with Tax both facilitate recruitment of CBP [13];
FF both phosphorylated and dephosphorylated CREB binds to enhancer cis-elements of the mouse Glut3 gene [16];
XX
IN T00968 ATF-1; human, Homo sapiens.
IN T01304 ATF-1; mouse, Mus musculus.
IN T01305 CBP100; mouse, Mus musculus.
IN T01318 CBP; mouse, Mus musculus.
IN T15118 CBP; Mammalia.
IN T00166 CREB-B; human, Homo sapiens.
IN T01314 CREMalpha; mouse, Mus musculus.
IN T01316 CREMgamma; mouse, Mus musculus.
IN T00165 deltaCREB; rat, Rattus norvegicus.
IN T01319 ICER; rat, Rattus norvegicus.
IN T01384 pX; HBV, human hepatitis B virus.
XX
MX M07248 V$CREB1_Q3.
MX M03544 V$CREB1_Q6.
MX M00981 V$CREBATF_Q6.
MX M00039 V$CREB_01.
MX M00113 V$CREB_02.
MX M00177 V$CREB_Q2.
MX M00916 V$CREB_Q2_01.
MX M00801 V$CREB_Q3.
MX M00178 V$CREB_Q4.
MX M00917 V$CREB_Q4_01.
MX M00114 V$TAXCREB_01.
MX M00115 V$TAXCREB_02.
XX
BS R04110.
BS R04577.
BS R12540.
BS R00456.
BS R00592.
BS R15485.
BS R01258.
BS R04029.
BS R00777.
BS R00779.
BS R19112.
BS R72795.
BS R60366.
BS R19108.
BS R02863.
BS R13377.
BS R73599.
BS R15965.
BS R14617.
BS R01841.
BS R15945.
BS R13176.
BS R04882.
BS R01534.
BS R71286.
BS R19110.
BS R19111.
BS R19109.
BS R01217.
BS R01358.
BS R03401.
BS R04884.
BS R04578.
BS R04579.
XX
DR TRANSPATH: MO000003368.
DR TRANSCOMPEL: C00187.
DR TRANSCOMPEL: C00392.
DR EMBL: M95106;
DR EMBL: X67719;
DR EMBL: X67721;
DR EMBL: X67722;
DR EMBL: X67724;
DR EMBL: X67725;
DR EMBL: X67726;
DR EMBL: X67727;
DR EMBL: X67728;
DR UniProtKB: Q01147-1;
XX
RN [1]; RE0000553.
RX PUBMED: 1532935.
RA Ruppert S., Cole T. J., Boshart M., Schmid E., Schuetz G.
RT Multiple mRNA isoforms of the transcription activator protein CREB: generation by alternative splicing and specific expression in primary spermatocytes
RL EMBO J. 13:1503-1512 (1992).
RN [2]; RE0001148.
RX PUBMED: 2304143.
RA Poteat H. T., Chen F. Y., Kadison P., Sodroski J. G., Haseltine W. A.
RT Protein Kinase A-dependent binding of a nuclear factor to the 21-base-pair repeat of the human T-cell leukemia virus type I long terminal repeat
RL J. Virol. 64:1264-1270 (1990).
RN [3]; RE0001913.
RX PUBMED: 8102791.
RA Brindle P., Linke S., Montminy M.
RT Protein-kinase-A-dependent activator in transcription factor CREB reveals new role for CREM repressors
RL Nature 364:821-824 (1993).
RN [4]; RE0001946.
RX PUBMED: 1387550.
RA Stauber C., Altschmied J., Akerblom I. E., Marron J. L., Mellon P. L.
RT Mutual cross-interference between glucocorticoid receptor and CREB inhibits transactivation in placental cells
RL New Biol. 4:527-540 (1992).
RN [5]; RE0002229.
RX PUBMED: 7687341.
RA Masson N., Hurst H. C., Lee K. A. W.
RT Identification of proteins that interact with CREB during differentiation of F9 embryonal carcinoma cells
RL Nucleic Acids Res. 21:1163-1169 (1993).
RN [6]; RE0002506.
RX PUBMED: 2142528.
RA Berkowitz L. A., Gilman M. Z.
RT Two distinct forms of active transcription factor CREB (cAMP response element binding protein)
RL Proc. Natl. Acad. Sci. USA 87:5258-5262 (1990).
RN [7]; RE0002562.
RX PUBMED: 8202541.
RA Adya N., Zhao L.-J., Huang W., Boros I., Giam C.-Z.
RT Expansion of CREB's DNA recognition specificity by Tax results from interaction with Ala-Ala-Arg at positions 282-284 near the conserved DNA-binding domain of CREB
RL Proc. Natl. Acad. Sci. USA 91:5642-5646 (1994).
RN [8]; RE0002563.
RX PUBMED: 8202542.
RA Hummler E., Cole T. J., Blendy J. A., Ganss R., Aguzzi A., Schmid W., Beermann F., Schuetz G.
RT Targeted mutation of the CREB gene: compensation within the CREB/ATF family of transcription factors
RL Proc. Natl. Acad. Sci. USA 91:5647-5651 (1994).
RN [9]; RE0005240.
RX PUBMED: 1889088.
RA Jones K. W., Shapero M. H., Chevrette M., Fournier R. E.
RT Subtractive hybridization cloning of a tissue-specific extinguisher: TSE1 encodes a regulatory subunit of protein kinase A.
RL Cell 66:861-872 (1991).
RN [10]; RE0005243.
RX PUBMED: 8336722.
RA Hagiwara M., Brindle P., Harootunian A., Armstrong R., Rivier J., Vale W., Tsien R., Montminy M. R.
RT Coupling of hormonal stimulation and transcription via the cyclic AMP-responsive factor CREB is rate limited by nuclear entry of protein kinase A
RL Mol. Cell. Biol. 13:4852-4859 (1993).
RN [11]; RE0005248.
RX PUBMED: 7923378.
RA Bourtchuladze R., Frenguelli B., Blendy J., Cioffi D., Schutz G., Silva A. J.
RT Deficient long-term memory in mice with a targeted mutation of the cAMP-responsive element-binding protein
RL Cell 79:59-68 (1994).
RN [12]; RE0005251.
RX PUBMED: 7516466.
RA Alberts A. S., Montminy M., Shenolikar S., Feramisco J. R.
RT Expression of a peptide inhibitor of protein phosphatase 1 increases phosphorylation and activity of CREB in NIH 3T3 fibroblasts
RL Mol. Cell. Biol. 14:4398-4407 (1994).
RN [13]; RE0005257.
RX PUBMED: 7913207.
RA Kwok R. P., Lundblad J. R., Chrivia J. C., Richards J. P., Baechinger H. P., Brennan R. G., Roberts S. G., Green M. R., Goodman R. H.
RT Nuclear protein CBP is a coactivator for the transcription factor CREB
RL Nature 370:223-226 (1994).
RN [14]; RE0006678.
RX PUBMED: 8605879.
RA Blendy J. A., Kaestner K. H., Schmid W., Gass P., Schuetz G.
RT Targeting of the CREB gene leads to up-regulation of a novel CREB mRNA isoform
RL EMBO J. 15:1098-1106 (1996).
RN [15]; RE0020181.
RX PUBMED: 1387109.
RA COLE T.J., COPELAND N.G., GILBERT D.J., JENKINS N.A., SCHUETZ G., RUPPERT R.
RT The mouse CREB (cAMP responsive element binding protein) gene: structure, promoter analysis, and chromosomal localization.
RL Genomics 13:974-982 (1992).
RN [16]; RE0025088.
RX PUBMED: 15054091.
RA Rajakumar A., Thamotharan S., Raychaudhuri N., Menon R. K., Devaskar S. U.
RT Trans-activators regulating neuronal glucose transporter isoform-3 gene expression in mammalian neurons.
RL J. Biol. Chem. 279:26768-26779 (2004).
RN [17]; RE0043219.
RX PUBMED: 12234923.
RA Eliopoulos A. G., Dumitru C. D., Wang C. C., Cho J., Tsichlis P. N.
RT Induction of COX-2 by LPS in macrophages is regulated by Tpl2-dependent CREB activation signals
RL EMBO J. 21:4831-40 (2002).
RN [18]; RE0049918.
RX PUBMED: 16293623.
RA Dodson G. E., Tibbetts R. S.
RT DNA replication stress-induced phosphorylation of cyclic AMP response element-binding protein mediated by ATM.
RL J. Biol. Chem. 281:1692-1697 (2006).
RN [19]; RE0051265.
RX PUBMED: 17296605.
RA Yamamoto T., Shimano H., Inoue N., Nakagawa Y., Matsuzaka T., Takahashi A., Yahagi N., Sone H., Suzuki H., Toyoshima H., Yamada N.
RT Protein kinase A suppresses sterol regulatory element-binding protein-1C expression via phosphorylation of liver X receptor in the liver.
RL J. Biol. Chem. 282:11687-11695 (2007).
RN [20]; RE0022665.
RX PUBMED: 12082086.
RA Casteel D. E., Zhuang S., Gudi T., Tang J., Vuica M., Desiderio S., Pilz R. B.
RT cGMP-dependent protein kinase I beta physically and functionally interacts with the transcriptional regulator TFII-I.
RL J. Biol. Chem. 277:32003-32014 (2002).
XX
//