TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00166 XX ID T00166 XX DT 01.06.1993 (created); ewi. DT 19.08.2011 (updated); pum. CO Copyright (C), QIAGEN. XX FA CREB-B XX SY cAMP response element-binding protein; CREB-327; CREB-B; CREB-isoform2; deltaCREB. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G004624 CREB1; HGNC: CREB1. XX HO ATF-43. XX CL C0008; bZIP; 1.1.7.1.1.2. XX SZ 327 AA; 35.1 kDa (cDNA) (calc.). XX SQ MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN SQ GQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSY SQ RKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLA SQ NNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQI SQ RTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENR SQ VAVLENQNKTLIEELKALKDLYCHKSD XX SC edited Swiss-Prot #P16220 XX FT 23 324 PF00478; IMP dehydrogenase / GMP reductase domain. FT 87 146 PS50953; KID. FT 99 139 PF02173; pKID domain. FT 267 325 SM00338; brlzneu. FT 267 327 PF00170; bZIP transcription factor. FT 269 320 PS50217; BZIP. XX SF basic region; SF zipper (L4); XX CP ubiquitous (placenta). XX FF splice variant from CREB (AA 88-101 of CREB missing); FF only 10% trans-activation capability compared to CREB; XX IN T00968 ATF-1; human, Homo sapiens. IN T01304 ATF-1; mouse, Mus musculus. IN T00051 ATF; human, Homo sapiens. IN T00163 CREB-A; human, Homo sapiens. IN T00166 CREB-B; human, Homo sapiens. IN T00164 CREB1; rat, Rattus norvegicus. IN T01385 CREB1; cattle, Bos taurus. IN T00989 CREB; mouse, Mus musculus. IN T01127 CREB; pig, Sus scrofa. IN T01307 CREB; hamster, Cricetulus sp. IN T01380 CREB; mink, Mustela vison. XX MX M07248 V$CREB1_Q3. MX M03544 V$CREB1_Q6. MX M00981 V$CREBATF_Q6. MX M00039 V$CREB_01. MX M00113 V$CREB_02. MX M00177 V$CREB_Q2. MX M00916 V$CREB_Q2_01. MX M00801 V$CREB_Q3. MX M00178 V$CREB_Q4. MX M00917 V$CREB_Q4_01. MX M00114 V$TAXCREB_01. MX M00115 V$TAXCREB_02. XX BS R00352. BS R00362. BS R04110. BS R04577. BS R04753. BS R04578. BS R04579. XX DR TRANSPATH: MO000024746. DR EMBL: S72459; DR UniProtKB: P16220-2; XX RN [1]; RE0000233. RX PUBMED: 2137373. RA Yamamoto K. K., Gonzalez G. A., Menzel P., Rivier J., Montminy M. R. RT Characterization of a bipartite activator domain in transcription factor CREB RL Cell 60:611-617 (1990). RN [2]; RE0001106. RX PUBMED: 1655749. RA Rehfuss R. P., Walton K. M., Loriaux M. M., Goodman R. H. RT The cAMP-regulated enhancer-binding protein ATF-1 activates transcription in response to cAMP-dependent protein kinase A RL J. Biol. Chem. 266:18431-18434 (1991). RN [3]; RE0001461. RX PUBMED: 2147221. RA Hurst H. C., Masson M., Jones N. C., Lee K. A. W. RT The cellular transcription factor CREB corresponds to activating transcription factor 47 (ATF-47) and forms complexes with a group of polypeptides related to ATF-43 RL Mol. Cell. Biol. 10:6192-6203 (1990). RN [4]; RE0001639. RX PUBMED: 2141384. RA Quinn P. G., Granner D. K. RT Cyclic AMP-dependent protein kinase regulates transcription of the phosphoenolpyruvate carboxykinase gene but not binding of nuclear factors to the cyclic AMP regulatory element RL Mol. Cell. Biol. 10:3357-3364 (1990). RN [5]; RE0002506. RX PUBMED: 2142528. RA Berkowitz L. A., Gilman M. Z. RT Two distinct forms of active transcription factor CREB (cAMP response element binding protein) RL Proc. Natl. Acad. Sci. USA 87:5258-5262 (1990). RN [6]; RE0002638. RX PUBMED: 2974179. RA Hoeffler J. P., Meyer T. E., Yun Y., Jameson J. L., Habener J. F. RT Cyclic AMP-responsive DNA-binding protein: structure based on a cloned placental cDNA RL Science 242:1430-1433 (1988). RN [7]; RE0003157. RX PUBMED: 2196176. RA Yoshimura T., Fujisawa J.-I., Yoshida M. RT Multiple cDNA clones encoding nuclear proteins that bind to the tax-dependent enhancer of HTLV-1: all contain a leucine zipper structure and basic amino acid domain RL EMBO J. 9:2537-2542 (1990). RN [8]; RE0004643. RX PUBMED: 8355695. RA Kerppola T. K., Curran T. RT Selective DNA bending by a variety of bZIP proteins RL Mol. Cell. Biol. 13:5479-5489 (1993). RN [9]; RE0005259. RX PUBMED: 7935435. RA Krajewski W., Lee K. A. W. RT A monomeric derivative of the cellular transcription factor CREB functions as a constitutive activator RL Mol. Cell. Biol. 14:7204-7210 (1994). XX //