TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01309 XX ID T01309 XX DT 22.10.1994 (created); ewi. DT 02.05.2014 (updated); jtr. CO Copyright (C), QIAGEN. XX FA CREMtau XX SY CREMtau. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G000532 Crem. XX CL C0008; bZIP. XX SZ 341 AA; 36.6 kDa (cDNA) (calc.). XX SQ MTMETVESQQDRSVTRSVAEHSSAHMQTGQISVPTLAQVSVAGSGTGRGSPAVTLVQLPS SQ GRTVQVQGVIQTPHPSVIQSPQIQTVQVATIAETDDSADSEVIDSHKRREILSRRPSYRK SQ ILNELSSDVPGIPKIEEEKSEEEGTPPNIATMAVPTSIYQTSTGQYIAIAQGGTIQISNP SQ GSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVPGSQVVVQDEETDLAPSHM SQ AAATGDMPTYQIRAPTTALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAAKEC SQ RRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTD XX SC edited Swiss-Prot #P27699 XX FT 1 316 PF00478; IMP dehydrogenase / GMP reductase domain. FT 85 144 PS50953; KID. FT 97 137 PF02173; pKID domain. FT 152 152 alternative translation initiation (S-CREM) [4]. FT 281 338 SM00338; brlzneu. FT 281 341 PF00170; bZIP transcription factor. FT 283 334 PS50217; BZIP. XX SF encoded by crem exons 1 (B), 2 (C), 3 (E), 4 (F), 5 (G), 6 (X), 7 (H), and the 3'-half of exon 8 (Ib) [12]; SF several splice variants [7]; SF compared to alpha, beta and gamma isoforms, CREMtau contains two additional glutamine-rich regions which exert an activating effect, the second one a stronger than the first one [1] [7]; XX CP adult testis; (much weaker:) neuroendocrine tissues [1]. XX FF activator [1] [7]; FF required for spermatid differentiation into sperms [8] [10]; FF abrupt switch from repressing CREM isoforms to CREMtau during spermatogenesis [1]; FF alternative initiation usage yields S-CREM; FF CREMtau is upregulated in CREB -/- mice; FF mediates PKA-dependent transcriptional stimulation involving Ser-117 [7]; FF Ser-117 is also phosphorylated by p70 S6 kinase [9]; FF along with Ser-117, additional sites are modified by CKI, CKII and other kinases and are thus targeted by several signalling cascades (cAMP, phorbols esters, calcium) [6]; FF these phosphorylations enhance the DNA-binding affinity [6]; XX IN T01316 CREMgamma; mouse, Mus musculus. IN T01309 CREMtau; mouse, Mus musculus. IN T01319 ICER; rat, Rattus norvegicus. XX MX M00981 V$CREBATF_Q6. MX M00916 V$CREB_Q2_01. MX M00801 V$CREB_Q3. MX M00917 V$CREB_Q4_01. MX M01820 V$CREM_Q6. MX M08803 V$CREM_Q6_01. XX BS R61604. BS R20995. BS R03925. BS R03926. BS R01358. XX DR TRANSPATH: MO000025571. DR EMBL: M60285; DR UniProtKB: P27699-1; XX RN [1]; RE0001912. RX PUBMED: 1370576. RA Foulkes N. S., Mellstroem B., Benusiglio E., Sassone-Corsi P. RT Developmental switch of CREM function during spermatogenesis: from antagonist to activator RL Nature 355:80-84 (1992). RN [2]; RE0001913. RX PUBMED: 8102791. RA Brindle P., Linke S., Montminy M. RT Protein-kinase-A-dependent activator in transcription factor CREB reveals new role for CREM repressors RL Nature 364:821-824 (1993). RN [3]; RE0001915. RX PUBMED: 8397338. RA Stehle J. H., Foulkes N. S., Molina C. A., Simonneaux V., Pevet P., Sassone-Corsi P. RT Adrenergic signals direct rhythmic expression of transcriptional repressor CREM in the pineal gland RL Nature 365:314-320 (1993). RN [4]; RE0002559. RX PUBMED: 1584756. RA Delmas V., Laoide B. M., Masquilier D., de Groot R. P., Foulkes N. S., Sassone-Corsi P. RT Alternative usage of initiation codons in mRNA encoding the cAMP-responsive-element modulator generates regulators with opposite functions RL Proc. Natl. Acad. Sci. USA 89:4226-4230 (1992). RN [5]; RE0002563. RX PUBMED: 8202542. RA Hummler E., Cole T. J., Blendy J. A., Ganss R., Aguzzi A., Schmid W., Beermann F., Schuetz G. RT Targeted mutation of the CREB gene: compensation within the CREB/ATF family of transcription factors RL Proc. Natl. Acad. Sci. USA 91:5647-5651 (1994). RN [6]; RE0003156. RX PUBMED: 8404858. RA de Groot R.P., den Hertog J., Vandenheede J.R., Goris J., Sassone-Corsi P. RT Multiple and cooperative phophorylation events regulate the CREM activator function RL EMBO J. 12:3903-3911 (1993). RN [7]; RE0003158. RX PUBMED: 8458330. RA Laoide B.M., Foulkes N.S., Schlotter F., Sassone-Corsi P. RT The functional versatility of CREM is determined by its modular structure RL EMBO J. 12:1179-1191 (1993). RN [8]; RE0005089. RX PUBMED: 8538765. RA Copeland J. W. R., Nasladka A., Dietrich B. H., Krause H. M. RT Patterning of the Drosophila embryo by a homeodomain-deleted Ftz polypeptide RL Nature 379:162-165 (1996). RN [9]; RE0005267. RX PUBMED: 7923380. RA de Groot R. P., Ballou L. M., Sassone-Corsi P. RT Positive regulation of the cAMP-responsive activator CREM by the p70 S6 kinase: an alternative route to mitogen-induced gene expression RL Cell 79:81-91 (1994). RN [10]; RE0005268. RX PUBMED: 8600390. RA Nantel F., Monaco L., Foulkes N. S., Masquilier D., LeMeur M., Henriksen K., Dierich A., Parvinen M., Sassone-Corsi P. RT Spermiogenesis deficiency and germ-cell apoptosis in CREM-mutant mice RL Nature 380:159-162 (1996). RN [11]; RE0005269. RX PUBMED: 7957042. RA Sassone-Corsi P. RT Goals for signal transduction pathways: linking up with transcriptional regulation RL EMBO J. 13:4717-4728 (1994). RN [12]; RE0000035. RX PUBMED: 6537904. RA Parker C. S., Topol J. RT A Drosophila RNA polymerase II transcription factor contains a promoter-region-specific DNA-binding activity RL Cell 36:357-369 (1984). XX //