TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01600 XX ID T01600 XX DT 28.11.1995 (created); ewi. DT 22.07.2004 (updated); vma. CO Copyright (C), QIAGEN. XX FA CREMdeltaC-G XX OS rat, Rattus norvegicus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G009771 Crem. XX CL C0008; bZIP. XX SZ 150 AA; 16.8 kDa (cDNA) (calc.), 16 kDa (SDS) [1] XX SQ MTMETVESQQDRSVTHSVAEHSSLHMQTGQISVPTLAQDEETDLAPSHMAAATGDMPTYQ SQ IRAPTTALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAARECRRKKKEYVKCL SQ ENRVAVLESQNKTLIEELKALKDLYCHKAE XX SC translated from EMBL #U04835 XX FT 90 148 SM00338; brlzneu. FT 90 150 PF00170; bZIP transcription factor. FT 92 143 PS50217; BZIP. XX SF encoded by crem gene exons 1, 6, 7, and 8a (5'-half of exon 8) [2]; SF lacks P box (phosphorylation sites) and both glutamine-rich inserts [1]; XX CP testis, round and elongated spermatids [1]. XX FF either as homodimer or as heterodimer with CREM or CREB: inhibitor of cAMP-mediated gene induction [1]; FF appears predominantly in mature haploid germ cells [1]; XX IN T00164 CREB1; rat, Rattus norvegicus. IN T01600 CREMdeltaC-G; rat, Rattus norvegicus. IN T01602 CREMtaualpha; mouse, Mus musculus. XX MX M00981 V$CREBATF_Q6. MX M00916 V$CREB_Q2_01. MX M00801 V$CREB_Q3. MX M00917 V$CREB_Q4_01. MX M01820 V$CREM_Q6. MX M08803 V$CREM_Q6_01. XX DR TRANSPATH: MO000025793. DR EMBL: U04835; DR UniProtKB: Q62613; Q62613. XX RN [1]; RE0003533. RX PUBMED: 7809053. RA Walker W. H., Sanborn B. M., Habener J. F. RT An isoform of transcription factor CREM expressed during spermatogenesis lacks the phosphorylation domain and represses cAMP-induced transcription RL Proc. Natl. Acad. Sci. USA 91:12423-12427 (1994). RN [2]; RE0000312. RX PUBMED: 3023048. RA Moncollin V., Miyamoto N. G., Zheng X. M., Egly J. M. RT Identification of a factor specific for the upstream element of the adenovirus-2 major late promoter RL EMBO J. 5:2577-2584 (1986). XX //