TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00719 XX ID T00719 XX DT 27.01.1993 (created); hse. DT 21.04.2009 (updated); ach. CO Copyright (C), QIAGEN. XX FA NR1B1-isoform1 XX SY NR1B1; RAR-alpha; retinoic acid receptor alpha. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G004665 RARA; HGNC: RARa. XX CL C0002; CC (rec); 2.1.2.1.1.1. XX SZ 462 AA; 50.8 kDa (cDNA) (calc.), 48.5 kDa (SDS) XX SQ MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPAT SQ IETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM SQ VYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTL SQ TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTV SQ EFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA SQ GFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALK SQ VYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL SQ DTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP XX SC translated from EMBL:BC008727 XX FT 82 167 DNA binding [24]. FT 85 156 SM00399; c4gold. FT 85 160 PS51030; NUCLEAR_REC_DBD_2. FT 86 161 PF00105; Zinc finger, C4 type (two domains). FT 88 108 zinc finger 1 (C-X2-C-X13-C-X2-C) [10]. FT 106 110 P-box [10]. FT 106 117 alpha-helix 1 [24]. FT 124 143 DNA dependent dimerization with RXR-alpha [24]. FT 124 143 zinc finger 2 (C-X5-C-X9-C-X2-C) [10]. FT 125 129 D-box [10]. FT 141 151 alpha-helix 2 [24]. FT 230 388 SM00430; holi. FT 233 413 PF00104; Ligand-binding domain of nuclear hormon. FT 369 391 helix 10 [30]. FT 396 415 helix 11 [30]. XX SF two splice variants; XX FF member of the steroid hormone receptor superfamily; FF negative regulator of AP-1 responsive genes, dependent on the DNA-binding domain of RAR and possibly via an unproductive complex with c-Jun; FF 1st zinc finger is the determinant of half-site spacing favoring 5 bp spacing; FF activator of HOXA1 T01696 by binding to a 3' enhancer retinoic acid responsive element (RARE) [22]; XX IN T08499 CBP; mouse, Mus musculus. IN T02184 cyclinH; human, Homo sapiens. IN T01362 Hp55; human, Homo sapiens. IN T01363 Hp65; human, Homo sapiens. IN T02187 MAT1; human, Homo sapiens. IN T02186 MO15; human, Homo sapiens. IN T04687 NCOR1; human, Homo sapiens. IN T04688 NCOR1; mouse, Mus musculus. IN T01427 p300; human, Homo sapiens. IN T01365 p45; human, Homo sapiens. IN T01364 p58; rat, Rattus norvegicus. IN T27173 Rbp2-isoform1; human, Homo sapiens. IN T01331 RXR-alpha; mouse, Mus musculus. IN T01345 RXR-alpha; human, Homo sapiens. IN T01359 RXR-alpha; clawed frog, Xenopus laevis. IN T01366 RXR-beta2; mouse, Mus musculus. IN T01332 RXR-beta; mouse, Mus musculus. IN T01334 RXR-beta; human, Homo sapiens. IN T01349 RXR-beta; rat, Rattus norvegicus. IN T04689 SMRT; human, Homo sapiens. IN T04640 SRC3; human, Homo sapiens. IN T00836 T3R-alpha1; mouse, Mus musculus. IN T01173 T3R-alpha2; mouse, Mus musculus. IN T00838 T3R-alpha; human, Homo sapiens. IN T00841 T3R-alpha; rat, Rattus norvegicus. IN T01351 T3R-alpha; chick, Gallus gallus. IN T00840 T3R; rat, Rattus norvegicus. IN T00854 T3R; monkey, Cercopithecus aethiops. IN T02183 TFIIH-p62; human, Homo sapiens. IN T02182 TFIIH-p80; human, Homo sapiens. IN T02181 TFIIH-p90; human, Homo sapiens. IN T02143 TIF1; mouse, Mus musculus. IN T01355 TRAP; human, Homo sapiens. XX MX M00965 V$DR4_Q2. MX M02110 V$NR1B1_Q6. MX M07280 V$NR1NR2_Q3. MX M02272 V$RXRRAR_01. MX M00963 V$T3R_Q6. XX BS R03941. BS R03943. BS R03944. BS R03945. BS R03964. BS R03965. BS R03966. BS R03967. BS R03968. BS R03969. BS R03970. BS R03971. BS R03972. BS R03973. BS R03974. BS R03975. BS R03976. BS R03977. BS R03978. BS R03979. BS R03981. BS R04772. BS R04773. BS R04774. BS R04405. BS R01465. BS R03949. BS R03953. BS R04765. BS R04766. BS R04767. BS R03017. BS R00135. BS R01187. BS R03942. BS R01321. BS R03929. BS R04759. BS R03963. BS R04761. BS R09141. BS R03928. BS R12027. BS R04075. BS R03962. BS R04768. BS R04769. BS R04770. BS R02240. BS R04758. BS R01169. BS R01690. BS R12073. BS R03931. XX DR TRANSPATH: MO000025129. DR TRANSCOMPEL: C00366. DR EMBL: BC008727; DR UniProtKB: P10276-1; XX RN [1]; RE0000117. RX PUBMED: 2159384. RA Schuele R., Umesono K., Mangelsdorf D. J., Bolado J., Pike J. W., Evans R. M. RT Jun-Fos and receptors for vitamins A and D recognize a common response element in the human osteocalcin gene RL Cell 61:497-504 (1990). RN [2]; RE0000265. RX PUBMED: 1310259. RA Leid M., Kastner P., Lyons R., Nakshatri H., Saunders M., Zacharewski T., Chen J.-Y., Staub A., Garnier J.-M., Mader S., Chambon P. RT Purification, cloning, and RXR identity of the HeLa cell factor with which RAR or TR heterodimerizes to bind target sequences efficiently RL Cell 68:377-395 (1992). RN [3]; RE0000266. RX PUBMED: 1662118. RA Yu V. C., Delsert C., Andersen B., Holloway J. M., Devary O. V., Naeaer A. M., Kim S. Y., Boutin J. M., Glass C. K., Rosenfeld M. G. RT RXRbeta: a coregulator that enhances binding of retinoic acid, thyroid hormone, and vitamin D receptors of their cognate response elements RL Cell 67:1251-1266 (1991). RN [4]; RE0000267. RX PUBMED: 2171781. RA Glass C. K., Devary O. V., Rosenfeld M. G. RT Multiple cell type-specific proteins differentially regulate target sequence recognition by the alpha retinoic acid receptor RL Cell 63:729-738 (1990). RN [5]; RE0000293. RX PUBMED: 1652422. RA Rowe A., Eager N. S. C., Brickell P. M. RT A member of the RXR nuclear receptor family is expressed in neural-crest-derived cells of the developing chick peripheral nervous system RL Development 111:771-778 (1991). RN [6]; RE0000470. RX PUBMED: 1850696. RA Vasios G., Mader S., Gold J. D., Leid M., Lutz Y., Gaub M.-P., Chambon P., Gudas L. RT The late retinoic acid induction of laminin B1 gene transcription involves RAR binding to the responsive element RL EMBO J. 10:1149-1158 (1991). RN [7]; RE0000554. RX PUBMED: 2176152. RA Nicholson R. C., Mader S., Nagpal S., Leid M., Rochette-Egly C., Chambon P. RT Negative regulation of the rat stromelysin gene promoter by retinoic acid is mediated by an AP1 binding site RL EMBO J. 9:4443-4454 (1990). RN [8]; RE0000689. RX PUBMED: 1846602. RA Ellinger-Ziegelbauer H., Dreyer C. RT A retinoic acid receptor expressed in the early development of Xenopus laevis RL Genes Dev. 5:94-104 (1991). RN [9]; RE0000791. RX PUBMED: 8436299. RA Tini M., Otulakowski G., Breitman M. L., Tsui L.-C., Giguere V. RT An everted repeat mediates retinoic acid induction of the gammaF-crystallin gene: evidence of a direct role for retinoids in lens development RL Genes Dev. 7:295-307 (1993). RN [10]; RE0000793. RX PUBMED: 8392478. RA Perlmann T., Rangarajan P. N., Umesono K., Evans R. M. RT Determinants for selective RAR and TR recognition of direct repeat HREs RL Genes Dev. 7:1411-1422 (1993). RN [11]; RE0001084. RX PUBMED: 8389356. RA Rosen E. D., Beninghof E. G., Koenig R. J. RT Dimerization interfaces of thyroid hormone, retinoic acid, vitamin D, and retinoid X receptors RL J. Biol. Chem. 268:11534-11541 (1993). RN [12]; RE0001739. RX PUBMED: 1656224. RA Lucas P. C., Forman B. M., Samuels H. H., Granner D. K. RT Specificity of a retinoic acid response element in the phosphoenolpyruvate carboxykinase gene promoter: consequences of both retinoic acid and thyroid hormone receptor binding RL Mol. Cell. Biol. 11:5164-5170 (1991). RN [13]; RE0001845. RX PUBMED: 2825025. RA Petkovich M., Brand N. J., Krust A., Chambon P. RT A human retinoic acid receptor which belongs to the family of nuclear receptors RL Nature 330:444-450 (1987). RN [14]; RE0001846. RX PUBMED: 2825036. RA Giguere V., Ong E. S., Segui P., Evans R. M. RT Identification of a receptor for the morphogen retinoic acid RL Nature 330:624-629 (1987). RN [15]; RE0001917. RX PUBMED: 1310350. RA Zhang X. K., Hoffmann B., Tran P. B.-V., Graupner G., Pfahl M. RT Retinoid X receptor is an auxiliary protein for thyroid hormone and retinoic acid receptors RL Nature 355:441-446 (1992). RN [16]; RE0001918. RX PUBMED: 1310351. RA Kliewer S. A., Umesono K., Mangelsdorf D. J., Evans R. M. RT Retinoid X receptor interacts with nuclear receptors in retinoic acid, thyroid hormone and vitamin D3 signalling RL Nature 355:446-449 (1992). RN [17]; RE0002468. RX PUBMED: 1848696. RA Lucas P. C., O'Brien R. M., Mitchell J. A., Davis C. M., Imai E., Forman B. M., Samuels H. H., Granner D. K. RT A retinoic acid response element is part of a pleiotropic domain in the phosphoenolpyruvate carboxykinase gene RL Proc. Natl. Acad. Sci. USA 88:2184-2188 (1991). RN [18]; RE0002476. RX PUBMED: 1850832. RA Yang N., Schuele R., Mangelsdorf D. J., Evans R. M. RT Characterization of DNA binding and retinoic acid binding properties of retinoic acid receptor RL Proc. Natl. Acad. Sci. USA 88:3559-3563 (1991). RN [19]; RE0002566. RX PUBMED: 1648728. RA Schuele R., Rangarajan P., Yang N., Kliewer S., Ransone L. J., Bolado J., Verma I. M., Evans R. M. RT Retinoic acid is a negative regulator of AP-1-responsive genes RL Proc. Natl. Acad. Sci. USA 88:6092-6096 (1991). RN [20]; RE0004734. RX PUBMED: 8616895. RA Kamei Y., Xu L., Heinzel T., Torchia J., Kurokawa R., Gloss B., Lin S.-C., Heyman R. A., Rose D. W., Glass C. K., Rosenfeld M. G. RT A CBP integrator complex mediates transcriptional activation and AP-1 inhibition by nuclear receptors RL Cell 85:403-414 (1996). RN [21]; RE0013625. RX PUBMED: 10219237. RA Nuclear Receptors Nomenclature Committee. RT A unified nomenclature system for the nuclear receptor superfamily RL Cell 97:161-163 (1999). RN [22]; RE0014859. RX PUBMED: 1360810. RA Langston A. W., Gudas L. J. RT Identification of a retinoic acid responsive enhancer 3' of the murine homeobox gene Hox-1.6 RL Mech. Dev. 38:217-227 (1992). RN [23]; RE0018149. RX PUBMED: 10337631. RA Hjalt T. A., Murray J. C. RT Genomic structure of the human retinoic acid receptor-alpha1 gene. RL Mamm. Genome 10:528-529 (1999). RN [24]; RE0022229. RX PUBMED: 10698945. RA Rastinejad F., Wagner T., Zhao Q., Khorasanizadeh S. RT Structure of the RXR-RAR DNA-binding complex on the retinoic acid response element DR1. RL EMBO J. 19:1045-1054 (2000). RN [25]; RE0039941. RX PUBMED: 11682061. RA Bastie J. N., Despouy G., Balitrand N., Rochette-Egly C., Chomienne C., Delva L. RT The novel co-activator CRABPII binds to RARalpha and RXRalpha via two nuclear receptor interacting domains and does not require the AF-2 'core' RL FEBS Lett. 507:67-73 (2001). RN [26]; RE0046545. RX PUBMED: 11358960. RA Chan S. W., Hong W. RT Retinoblastoma-binding protein 2 (Rbp2) potentiates nuclear hormone receptor-mediated transcription RL J. Biol. Chem. 276:28402-12 (2001). RN [27]; RE0047648. RX PUBMED: 15336696. RA Loinder K., Soderstrom M. RT Functional analyses of an LXXLL motif in nuclear receptor corepressor (N-CoR). RL J. Steroid Biochem. Mol. Biol. 91:191-196 (2004). RN [28]; RE0047743. RX PUBMED: 15610520. RA Flores A. M., Li L., Aneskievich B. J. RT Isolation and functional analysis of a keratinocyte-derived, ligand-regulated nuclear receptor comodulator. RL J. Invest. Dermatol 123:1092-1101 (2004). RN [29]; RE0048057. RX PUBMED: 16055921. RA Martin P. J., Lardeux V., Lefebvre P. RT The proliferating cell nuclear antigen regulates retinoic acid receptor transcriptional activity through direct protein-protein interaction. RL Nucleic Acids Res. 33:4311-4321 (2005). RN [30]; RE0049022. RX PUBMED: 9660764. RA Chinpaisal C., Lee C. H., Wei L. N. RT Mechanisms of the mouse orphan nuclear receptor TR2-11-mediated gene suppression. RL J. Biol. Chem. 273:18077-18085 (1998). XX //