TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00836 XX ID T00836 XX DT 28.01.1993 (created); hse. DT 11.03.2010 (updated); jtr. CO Copyright (C), QIAGEN. XX FA T3R-alpha1 XX SY c-ErbA; NR1A1; T3R; THRA; thyroid hormone receptor; TR. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G002946 Thra. XX CL C0002; CC (rec); 2.1.2.2.1.1. XX SZ 410 AA; 46.8 kDa (calc.), 46 kDa XX SQ MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCPLKSSMSGYIPSYLDKDEQCVVCGDKA SQ TGYHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGM SQ AMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHVATEAHRSTNA SQ QGSHWKQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFS SQ ELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVVSDAIF SQ ELGKSLSAFNLDDTEVALLQAVLLMSTDRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNI SQ PHFWPKLLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFEDQEV XX SC translated from EMBL #X51983 XX FT 50 123 SM00399; c4gold. FT 50 127 PS51030; NUCLEAR_REC_DBD_2. FT 51 128 PF00105; Zinc finger, C4 type (two domains). FT 83 329 PF00478; IMP dehydrogenase / GMP reductase domai. FT 220 378 SM00430; holi. FT 223 404 PF00104; Ligand-binding domain of nuclear hormon. XX SF phosphorylation; SF another splice variant produced from the same gene is T3R-alpha2 T01173; XX FF member of the steroid hormone receptor superfamily; XX IN T00719 NR1B1-isoform1; human, Homo sapiens. IN T00720 RAR-gamma; human, Homo sapiens. IN T00716 RAR; monkey, Cercopithecus aethiops. IN T00717 RAR; mouse, Mus musculus. XX MX M01724 V$T3RALPHA_Q6. MX M00963 V$T3R_Q6. XX BS R30669. BS R29414. BS R72843. BS R72242. BS R72241. BS R03523. XX DR TRANSPATH: MO000025207. DR EMBL: X51983; DR UniProtKB: P63058-2; XX RN [1]; RE0001498. RX PUBMED: 1922030. RA Lazar M. A., Berrodin T. J., Harding H. P. RT Differential DNA binding by monomeric, homodimeric, and potentially heteromeric forms of the thyroid hormone receptor RL Mol. Cell. Biol. 11:5005-5015 (1991). RN [2]; RE0001752. RX PUBMED: 2172797. RA Forman B. M., Samuels H. H. RT Interactions among a subfamily of nuclear hormone receptors: the regulatory zipper model RL Mol. Endocrinol. 4:1293-1301 (1990). RN [3]; RE0002738. RX PUBMED: 2159385. RA Baniahmad A., Steiner C., Koehne A. C., Renkawitz R. RT Modular structure of a chicken lysozyme silencer: involvement of an unusual thyroid hormone receptor binding site RL Cell 61:505-514 (1990). XX //