AC T00459
XX
ID T00459
XX
DT 23.03.1993 (created); ewi.
DT 11.12.2013 (updated); mkl.
CO Copyright (C), QIAGEN.
XX
FA C/EBPbeta-FL
XX
SY AGP/EBP (mouse); ANF-2; C/EBP beta; C/EBP-related protein 2; C/EBPbeta; C/EBPbeta(LAP); C/EBPbeta(p35); C/EBPbeta1; CCAAT/enhancer binding protein (C/EBP), beta; CCAAT/enhancer binding protein beta; CEBPB; CRP2; H-APF-2; IL-6DBP; IL6DBP; interleukin-6-dependent binding protein; LAP; LAP1; LF-H3beta; liver-enriched transcriptional activator; NF-IL6; NF-M; p35-C/EBPbeta; SF-B; SFB; silencer factor B; TCF5.
XX
OS rat, Rattus norvegicus
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae
XX
GE G013627 Cebpb.
XX
CL C0008; bZIP.
XX
SZ 297 AA; 31.5 kDa (cDNA) (calc.), 38 kDa (SDS)
XX
SQ MHRLLAWDAACLPPPPAAFRPMEVANFYYEPDCLAYGAKAARAAPRAPAAEPAIGEHERA
SQ IDFSPYLEPLAPAAADFAAPAPAHHDFLSDLFADDYGAKPSKKPSDYGYVSLGRAGAKAA
SQ PPACFPPPPPAALKAEPGFEPADCKRADDAPAMAAGFPFALRAYLGYQATPSGSSGSLST
SQ SSSSSPPGTPSPADAKAAPAACFAGPPAAPAKAKAKKAVDKLSDEYKMRRERNNIAVRKS
SQ RDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASAGHC
XX
SC Swiss-Prot#P21272-1
XX
FT 22 31 
activation module 1 (ADM1) [15].
FT 22 297 
alternative translation product (p34) [11].
FT 54 72 
activation module 2 (ADM2) [15].
FT 84 93 
activation module 3 (ADM3) [15].
FT 85 95 
hydrophobic region mediating contact to basal transcription machinery [17].
FT 105 105 
phosphorylated Ser [8].
FT 137 170 
regulatory domain 1 (RD1) [15].
FT 137 212 
regulatory domain [15].
FT 153 297 
alternative translation product (LIP) [11].
FT 184 212 
regulatory domain 2 (RD2) [15].
FT 187 190 PGTP motif recognized by MAPK [23].
FT 189 189 interaction with SRF, Ras-stimulated [23].
FT 221 285 SM00338; brlzneu.
FT 222 275 PF07716; Basic region leucine zipper.
FT 223 286 PS50217; BZIP.
XX
SF alternative translation initiation at Met-153 gives rise to LIP T01420 [11] [16];
SF initiation at Met-22 results in p34 [11];
SF half-saturation DNA-binding at 0.71 nM [11];
SF C/EBPbeta may adopt a tightly folded conformation masking its trans-activating and the DNA-binding domain [15];
SF DBD is important for interactions with NF-ATc4 [22];
SF C-terminal region is sufficient to mediate interactions with A-box of Elk-1 [21];
XX
CP liver (high); muscle, heart, thyroid, lung; less in spleen, gut, kidney, stomach [2] [3].
CN thymus, brain, testis [2] [3].
XX
FF activator [23] [2] [3] [21];
FF involved in acute phase reactions, inflammation and hematopoiesis, may be a master gene of these responses [12] [2];
FF increases the transcriptional stimulation by glucocorticoids [13];
FF ectopic expression is sufficient for IL-6 expression after induction by LPS [14];
FF Ser-105 phosphorylation by PKC enhances transcription activation [8];
FF can be induced in PC12 cells by forskolin, leading to association with a pp43 and a p64;
FF also induced by IL-1, IL-6, LPS [2];
FF arrests cell cycle of hepatoma cells before G1/S boundary [18];
FF acts cooperatively and physically interacts with NF-ATc4 upon the regulation of PPARgamma promoter 2 [22];
FF functions synergistically and directly interacts with Elk-1 and SRF [21];
XX
IN T01303 ATF-4; human, Homo sapiens.
IN T00051 ATF; human, Homo sapiens.
IN T05452 BAF155; human, Homo sapiens.
IN T05499 BAF47; human, Homo sapiens.
IN T05451 BRG1; human, Homo sapiens.
IN T01261 Brm; human, Homo sapiens.
IN T00106 C/EBP; fruit fly, Drosophila melanogaster.
IN T01386 C/EBP; Aplysia, Aplysia californica.
IN T01388 C/EBP; clawed frog, Xenopus laevis.
IN T00104 C/EBPalpha-isoform1; mouse, Mus musculus.
IN T00108 C/EBPalpha-isoform1; rat, Rattus norvegicus.
IN T00105 C/EBPalpha; human, Homo sapiens.
IN T00107 C/EBPalpha; chick, Gallus gallus.
IN T00459 C/EBPbeta-FL; rat, Rattus norvegicus.
IN T02105 C/EBPbeta-LAP; rat, Rattus norvegicus.
IN T01420 C/EBPbeta-LIP; rat, Rattus norvegicus.
IN T00109 C/EBPdelta; rat, Rattus norvegicus.
IN T00583 C/EBPdelta; human, Homo sapiens.
IN T01114 C/EBPdelta; mouse, Mus musculus.
IN T00171 C/EBPepsilon; rat, Rattus norvegicus.
IN T00127 CHOP-10; mouse, Mus musculus.
IN T06555 CHOP-10; rat, Rattus norvegicus.
IN T00250 Elk-1; human, Homo sapiens.
IN T02462 NFATc4; human, Homo sapiens.
IN T01427 p300; human, Homo sapiens.
IN T00764 SRF; human, Homo sapiens.
XX
MX M00109 V$CEBPB_01.
MX M00117 V$CEBPB_02.
MX M07315 V$CEBPB_Q3.
MX M01896 V$CEBPB_Q6.
MX M00912 V$CEBP_Q2_01.
MX M00770 V$CEBP_Q3.
XX
BS R06682.
BS R06683.
BS R06684.
BS R06685.
BS R06686.
BS R06687.
BS R06688.
BS R06689.
BS R06690.
BS R06691.
BS R06692.
BS R06693.
BS R06694.
BS R06695.
BS R06696.
BS R06697.
BS R06698.
BS R06699.
BS R06700.
BS R06701.
BS R06702.
BS R06789.
BS R06790.
BS R06791.
BS R06792.
BS R06793.
BS R06794.
BS R06795.
BS R06796.
BS R06797.
BS R06798.
BS R06799.
BS R06800.
BS R06801.
BS R06802.
BS R06803.
BS R06804.
BS R06805.
BS R00207.
BS R08477.
BS R04575.
BS R04912.
BS R16635.
BS R03251.
BS R03128.
BS R03243.
BS R25581.
BS R16633.
BS R24131.
BS R04476.
BS R04477.
BS R00460.
BS R00464.
BS R04047.
BS R04492.
BS R03152.
BS R29614.
BS R14609.
BS R04506.
BS R00089.
BS R28689.
BS R08105.
BS R01463.
BS R02216.
BS R00097.
BS R04514.
BS R03322.
BS R04507.
BS R04511.
BS R04512.
BS R08096.
BS R08112.
BS R08113.
BS R05074.
BS R04494.
BS R08138.
BS R01184.
BS R01185.
BS R08121.
BS R03732.
BS R16332.
BS R01358.
BS R08135.
BS R08136.
BS R01344.
XX
DR TRANSPATH: MO000002640.
DR TRANSCOMPEL: C00101.
DR TRANSCOMPEL: C00270.
DR TRANSCOMPEL: C00321.
DR TRANSCOMPEL: C00330.
DR TRANSCOMPEL: C00413.
DR TRANSCOMPEL: C00440.
DR EMBL: M57235;
DR EMBL: M84011;
DR EMBL: S77528; S77528.
DR EMBL: X54626;
DR EMBL: X60769;
DR UniProtKB: P21272-1;
XX
RN [1]; RE0000043.
RX PUBMED: 3690666.
RA Lichtsteiner S., Wuarin J., Schibler U.
RT The Interplay of DNA-Binding Proteins on the Promoter of the Mouse Albumin Gene
RL Cell 51:963-973 (1987).
RN [2]; RE0000177.
RX PUBMED: 2171780.
RA Poli V., Mancini F. P., Cortese R.
RT IL-6DBP, a nuclear protein involved in interleukin-6 signal transduction, defines a new family of leucine zipper proteins related to C/EBP
RL Cell 63:643-653 (1990).
RN [3]; RE0000686.
RX PUBMED: 2253878.
RA Descombes P., Chojkier M., Lichtsteiner S., Falvey E., Schibler U.
RT LAP, a novel member of the C/EBP gene family, encodes a liver-enriched transcriptional activator protein
RL Genes Dev. 4:1541-1551 (1990).
RN [4]; RE0000742.
RX PUBMED: 1884998.
RA Williams S. C., Cantwell C. A., Johnson P. F.
RT A family of C/EBP-related proteins capable of forming covalently linked leucine zipper dimers in vitro
RL Genes Dev. 5:1553-1567 (1991).
RN [5]; RE0000767.
RX PUBMED: 1655570.
RA Metz R., Ziff E.
RT cAMP stimulates the C/EBP-related transcription factor rNFIL-6 to trans-locate to the nucleus and induce c-fos transcription
RL Genes Dev. 5:1754-1766 (1991).
RN [6]; RE0000787.
RX PUBMED: 8504929.
RA Vinson C. R., Hai T., Boyd S. M.
RT Dimerization specificity of the leucine zipper-containing bZIP motif on DNA binding: prediction and rational design
RL Genes Dev. 7:1047-1058 (1993).
RN [7]; RE0001491.
RX PUBMED: 1717823.
RA Williams P., Ratajczak T., Lee S. C., Ringold G. M.
RT AGP/EBP(LAP) expressed in rat hepatoma cells interacts with multiple promoter sites and is necessary for maximal glucocorticoid induction of the rat alpha-1 acid glycoprotein gene
RL Mol. Cell. Biol. 11:4959-4965 (1991).
RN [8]; RE0001926.
RX PUBMED: 8336793.
RA Trautwein C., Caelles C., van der Geer P., Hunter T., Karin M., Chojkier M.
RT Transactivation by NF-IL6/LAP is enhanced by phosphorylation of its activation domain
RL Nature 364:544-547 (1993).
RN [9]; RE0002248.
RX PUBMED: 1766666.
RA Metz R., Ziff E.
RT The helix-loop-helix protein rE12 and the C/EBP-related factor rNFIL-6 bind to neighboring sites within the c-fos serum response element
RL Oncogene 6:2165-2178 (1991).
RN [10]; RE0002643.
RX PUBMED: 2711183.
RA Maire P., Wuarin J., Schibler U.
RT The Role of Cis-Acting Promoter Elements in Tissue-Specific Albumin Gene Expression
RL Science 244:343-346 (1989).
RN [11]; RE0002865.
RX PUBMED: 1934061.
RA Descombes P., Schibler U.
RT A liver-enriched transcriptional activator protein, LAP, and a transcriptional inhibitory protein, LIP, are translated from the same mRNA
RL Cell 67:569-579 (1991).
RN [12]; RE0002900.
RX PUBMED: 2479021.
RA Poli V., Cortese R.
RT Interleukin 6 induces a liver-specific nuclear protein that binds to the promoter of acute-phase genes
RL Proc. Natl. Acad. Sci. USA 86:8202-8206 (1989).
RN [13]; RE0003028.
RX PUBMED: 1382074.
RA Baumann H., Morella K. K., Campos S. P., Cao Z., Jahreis G. P.
RT Role of CAAT-enhancer binding protein isoforms in the cytokine regulation of acute-phase plasma protein genes
RL J. Biol. Chem. 267:19744-19751 (1992).
RN [14]; RE0003034.
RX PUBMED: 8041785.
RA Bretz J. D., Williams S. C., Baer M., Johnson P. F., Schwartz R. C.
RT C/EBP-related protein 2 confers lipopolysaccharide-inducible expression of interleukin 6 and monocyte chemoattractant protein 1 to a lymphoblastic cell line
RL Proc. Natl. Acad. Sci. USA 91:7306-7310 (1994).
RN [15]; RE0003538.
RX PUBMED: 7621830.
RA Williams S. C., Baer M., Dillner A. J., Johnson P. F.
RT CRP2 (C/EBPbeta) contains a bipartite regulatory domain that controls transcriptional activation, DNA binding and cell specificity
RL EMBO J. 14:3170-3183 (1995).
RN [16]; RE0005297.
RX PUBMED: 8367486.
RA Ossipow V., Descombes P., Schibler U.
RT CCAAT/enhancer-binding protein mRNA is translated into multiple proteins with different transcription activation potentials
RL Proc. Natl. Acad. Sci. USA 90:8219-8223 (1993).
RN [17]; RE0006238.
RX PUBMED: 7797496.
RA Trautwein C., Walker D. L., Pluempe J., Manns M. P.
RT Transactivation of LAP/NF-IL6 is mediated by an acidic domain in the N-terminal part of the protein
RL J. Biol. Chem. 270:15130-15136 (1995).
RN [18]; RE0007044.
RX PUBMED: 7906646.
RA Buck M., Turler H., Chojkier M.
RT LAP (NF-IL-6), a tissue-specific transcriptional activator, is an inhibitor of hepatoma cell proliferation
RL EMBO J. 13:851-860 (1994).
RN [19]; RE0007055.
RX PUBMED: 8007984.
RA Sears R. C., Sealy L.
RT Multiple forms of C/EBP beta bind the EFII enhancer sequence in the Rous sarcoma virus long terminal repeat
RL Mol. Cell. Biol. 14:4855-4871 (1994).
RN [20]; RE0009831.
RX PUBMED: 8065319.
RA Rana B., Mischoulon D., Xie Y., Bucher N. L. R., Farmer S. R.
RT Cell-extracellular matrix interactions can regulate the switch between growth and differentiation in rat hepatocytes: reciprocal expression of C/EBPalpha and immediate-early growth response transcription factors
RL Mol. Cell. Biol. 14:5858-5869 (1994).
RN [21]; RE0016725.
RX PUBMED: 11151091.
RA Hanlon M., Bundy L. M., Sealy L.
RT C/EBPBeta and Elk-1 synergistically transactivate the c-fos serum response element.
RL BMC Cell Biol. 1:2 (2000).
RN [22]; RE0023877.
RX PUBMED: 12606546.
RA Yang T. T., Chow C. W.
RT Transcription cooperation by NFAT.C/EBP composite enhancer complex.
RL J. Biol. Chem. 278:15874-15885 (2003).
RN [23]; RE0025209.
RX PUBMED: 10318842.
RA Hanlon M., Sealy L.
RT Ras regulates the association of serum response factor and CCAAT/enhancer-binding protein beta.
RL J. Biol. Chem. 274:14224-14228 (1999).
RN [24]; RE0048226.
RX PUBMED: 10635333.
RA Buck M., Poli V., van der Geer P., Chojkier M., Hunter T.
RT Phosphorylation of rat serine 105 or mouse threonine 217 in C/EBP beta is required for hepatocyte proliferation induced by TGF alpha.
RL Mol. Cell 4:1087-1092 (1999).
RN [25]; RE0070844.
RX PUBMED: 20351173.
RA Lee S., Shuman J. D., Guszczynski T., Sakchaisri K., Sebastian T., Copeland T. D., Miller M., Cohen M. S., Taunton J., Smart R. C., Xiao Z., Yu L. R., Veenstra T. D., Johnson P. F.
RT RSK-mediated phosphorylation in the C/EBP{beta} leucine zipper regulates DNA binding, dimerization, and growth arrest activity.
RL Mol. Cell. Biol. 30:2621-2635 (2010).
XX
//