AC T00104
XX
ID T00104
XX
DT 15.10.1992 (created); ewi.
CO Copyright (C), QIAGEN.
XX
FA C/EBPalpha-isoform1
XX
SY BPc; C/EBP; C/EBP alpha; C/EBPalpha; C/EBPalpha(p42); CBP; CCAAT Enhancer Binding Protein alpha; CCAAT/enhancer binding protein alpha; CEBPA; EBP20; p42(C/EBPalpha); p42C/EBPalpha.
XX
OS mouse, Mus musculus
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae
XX
GE G000490 Cebpa.
XX
CL C0008; bZIP.
XX
SZ 359 AA; 37.4 kDa (cDNA) (calc.), 42 kDa (SDS) [19]
XX
SQ MESADFYEVEPRPPMSSHLQSPPHAPSNAAFGFPRGAGPAPPPAPPAAPEPLGGICEHET
SQ SIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAAGPAGGGGDFDYPGAPAGPGGAVMSA
SQ GAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQ
SQ PPPPPPPPHPHASPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHAAPALGAA
SQ GLPGPGSALKGLAGAHPDLRTGGGGGGSGAGAGKAKKSVDKNSNEYRVRRERNNIAVRKS
SQ RDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA
XX
SC translated from EMBL:BC011118
XX
FT 118 118 
alternative translation codon [18].
XX
SF length is 359 AA according to [9];
SF length is 395 AA (ORF in EMBL #M62362);
SF alternative translation initiation product is C/EBPalpha-isoform1 (p30 variant) T02026;
SF C/EBPalpha-isoform1 exhibits a very relaxed DNA-binding specificity [6];
SF the N-terminal part of the molecule exhibits antimitotic activity [18];
XX
CP (liver); A4 and WEHI 3BD cells [24].
XX
FF critically involved in energy homeostasis and may have a role in regulating the balance between cell growth and differentiation [3] [20] [1];
FF knock-out mice are unable to store hepatic glycogen and die from hypoglycemia [20];
FF Myc/Max heterodimers bind to and represses the C/EBPalpha-isoform1 promoter [16];
FF TNF-alpha reduces the level of C/EBPalpha-isoform1 and, thus, the expression of its target genes [14];
FF LPS also reduces levels of C/EBPalpha-isoform1(p42) protein in liver, but raises that of a 20 kDa isoform probably due to shifting translation to another AUG codon [19];
FF subject to positive autoregulation [16] [9];
FF insulin down-regulates C/EBPalpha-isoform1 and mediates its dephosphorylation in fully-differentiated adipocytes [21];
FF interacts with NF-ATc2 in adipocytes [23];
XX
IN T01303 ATF-4; human, Homo sapiens.
IN T00104 C/EBPalpha-isoform1; mouse, Mus musculus.
IN T00017 C/EBPbeta-FL; mouse, Mus musculus.
IN T00459 C/EBPbeta-FL; rat, Rattus norvegicus.
IN T00109 C/EBPdelta; rat, Rattus norvegicus.
IN T01114 C/EBPdelta; mouse, Mus musculus.
IN T00216 C/EBPgamma; mouse, Mus musculus.
IN T00127 CHOP-10; mouse, Mus musculus.
IN T01944 NFATc2; mouse, Mus musculus.
XX
MX M00116 V$CEBPA_01.
MX M07037 V$CEBPA_Q4.
MX M01866 V$CEBPA_Q6.
MX M00159 V$CEBP_01.
MX M00201 V$CEBP_C.
MX M00190 V$CEBP_Q2.
MX M00912 V$CEBP_Q2_01.
MX M00770 V$CEBP_Q3.
MX M00249 V$CHOP_01.
XX
BS R02132.
BS R04246.
BS R04247.
BS R04592.
BS R04911.
BS R04603.
BS R03666.
BS R04255.
BS R14487.
BS R02908.
BS R15892.
BS R02678.
BS R08097.
BS R08098.
BS R08099.
BS R08100.
BS R03135.
BS R01817.
BS R01818.
BS R14479.
BS R20515.
BS R28302.
BS R02460.
BS R02461.
BS R19656.
BS R13172.
BS R01841.
BS R13310.
BS R13311.
BS R01700.
BS R13285.
BS R08089.
BS R08090.
XX
DR TRANSPATH: MO000002634.
DR TRANSCOMPEL: C00413.
DR EMBL: BC011118;
DR EMBL: BC028890;
DR EMBL: BC051102;
DR EMBL: BC058161;
DR UniProtKB: P53566;
XX
RN [1]; RE0000504.
RX PUBMED: 1935900.
RA Samuelsson L., Stroemberg K., Vikman K., Bjursell G., Enerbaeck S.
RT The CCAAT/enhancer binding protein and its role in adipocyte differentiation: evidence for direct involvement in terminal adipocyte development
RL EMBO J. 10:3787-3793 (1991).
RN [2]; RE0000630.
RX PUBMED: 2606350.
RA Christy R. J., Yang V. W., Ntambi J. M., Geiman D. E., Landschulz W. H., Friedman A. D., Nakabeppu Y., Kelly T. J., Lane M. D.
RT Differentiation-induced gene expression in 3T3-L1 preadipocytes: CCAAT/ enhancer binding protein interacts with and activates the promoters of two adipocyte-specific genes
RL Genes Dev. 3:1323-1335 (1989).
RN [3]; RE0001410.
RX PUBMED: 2511432.
RA Herrera R., Ro H. S., Robinson G. S., Xanthopoulos K. G., Spiegelman B. M.
RT A Direct Role for C/EBP and the AP-I-Binding Site in Gene Expression Linked to Adipocyte Differentiation
RL Mol. Cell. Biol. 9:5331-5339 (1989).
RN [4]; RE0001441.
RX PUBMED: 1692957.
RA Montgomery K. T., Tardiff J. T., Reid L. M., Krauter K. S.
RT Negative and Positive cis-Acting Elements Control the Expression of Murine alpha1-Protease Inhibitor Genes
RL Mol. Cell. Biol. 10:2625-2637 (1990).
RN [5]; RE0001467.
RX PUBMED: 2147222.
RA Park E. A., Roesler W. J., Liu J., Klemm D. J., Gurney A. L., Thatcher J. D., Shuman J., Friedman A., Hanson R. W.
RT The role of the CCAAT/enhancer-binding protein in the transcriptional regulation of the gene for phosphoenolpyruvate carboxykinase (GTP)
RL Mol. Cell. Biol. 10:6264-6272 (1990).
RN [6]; RE0002266.
RX PUBMED: 2836860.
RA Costa R. H., Grayson D. R., Xanthopoulos K. G., Darnell jr J. E.
RT A liver-specific DNA-binding protein recognizes multiple nucleotide sites in regulatory regions of transthyretin, alpha1-antitrypsin, albumin, and simian virus 40 genes
RL Proc. Natl. Acad. Sci. USA 85:3840-3844 (1988).
RN [7]; RE0002374.
RX PUBMED: 2404278.
RA Kaestner K. H., Christy R. J., Lane M. D.
RT Mouse insulin-responsive glucose transporter gene: Characterization of the gene and trans-activation by the CCAAT/enhancer binding protein
RL Proc. Natl. Acad. Sci. USA 87:251-255 (1990).
RN [8]; RE0002485.
RX PUBMED: 2726767.
RA Xanthopoulos K. G., Mirkovitch J., Decker T., Kuo C. F., Darnell jr J. E.
RT Cell-specific transcriptional control of the mouse DNA-binding protein mC/EBP
RL Proc. Natl. Acad. Sci. USA 86:4117-4121 (1989).
RN [9]; RE0002486.
RX PUBMED: 2006196.
RA Christy R. J., Kaestner K. H., Geiman D. E., Lane M. D.
RT CCAAT/enhancer binding protein gene promoter: binding of nuclear factors during differentiation of 3T3-L1 preadipocytes
RL Proc. Natl. Acad. Sci. USA 88:2593-2597 (1991).
RN [10]; RE0002589.
RX PUBMED: 3257586.
RA Grayson D. R., Costa R. H., Xanthopoulos K. G., Darnell J. E.
RT One Factor Recognizes the Liver-Specific Enhancers in alpha1-Antitrypsin and Transthyretin Genes
RL Science 239:786-788 (1988).
RN [11]; RE0002710.
RX PUBMED: 8211160.
RA Wagner S., Green M. R.
RT HTLV-I Tax protein stimulation of DNA binding of bZIP proteins by enhancing dimerization
RL Science 262:395-399 (1993).
RN [12]; RE0002732.
RX PUBMED: 1840554.
RA Cao Z., Umek R. M., McKnight S. L.
RT Regulated expression of three C/EBP isoforms during adipose conversion of 3T3-L1 cells
RL Genes Dev. 5:1538-1552 (1991).
RN [13]; RE0002747.
RX PUBMED: 2161847.
RA Metzger S., Leff T., Breslow J. L.
RT Nuclear factors AF-1 and C/EBP bind to the human ApoB gene promoter and modulate its transcriptional activity in hepatic cells
RL J. Biol. Chem. 265:9978-9983 (1990).
RN [14]; RE0003020.
RX PUBMED: 1939208.
RA Stephens J. M., Pekala P. H.
RT Transcriptional repression of the GLUT4 and C/EBP genes in 3T3-L1 adipocytes by tumor necrosis factor-alpha
RL J. Biol. Chem. 266:21839-21845 (1991).
RN [15]; RE0003023.
RX PUBMED: 1371993.
RA Alam T., An M. R., Papaconstantinou J.
RT Differential expression of three C/EBP isoforms in multiple tissues during the acute phase response
RL J. Biol. Chem. 267:5021-5024 (1992).
RN [16]; RE0003025.
RX PUBMED: 8493090.
RA Legraverend C., Antonson P., Flodby P., Xanthopoulos K. G.
RT High level activity of the mouse CCAAT/enhancer binding protein (C/EBPalpha) gene promoter involves autoregulation and several ubiquitous transcription factors
RL Nucleic Acids Res. 21:1735- 1742 (1993).
RN [17]; RE0003026.
RX PUBMED: 8090719.
RA Lin F. -T., Lane M. D.
RT CCAAT/enhancer binding protein alpha is sufficient to initiate the 3T3-L1 adipocyte differentiation program
RL Proc. Natl. Acad. Sci. USA 91:8757-8761 (1994).
RN [18]; RE0003173.
RX PUBMED: 8415748.
RA Lin F.-T., MacDougald O.A., Diehl A.M., Lane M.D.
RT A 30-kDa alternative translation product of the CCAAT/enhancer binding protein alpha message: Transcriptional activator lacking antimitotic activity
RL Proc. Natl. Acad. Sci. USA 90:9606-9610 (1993).
RN [19]; RE0006628.
RX PUBMED: 8628296.
RA An M. R., Hsieh C.-C., Reisner P. D., Rabek J. P., Scott S. G., Kuninger D. T., Papaconstantinou J.
RT Evidence for posttranscriptional regulation of C/EBPalpha and C/EBPbeta isoform expression during the lipopolysaccharide-mediated acute-phase response
RL Mol. Cell. Biol. 16:2295-2306 (1996).
RN [20]; RE0006668.
RX PUBMED: 7652557.
RA Wang N. D., Finegold M. J., Bradley A., Ou C. N., Abdelsayed S. V., Wilde M. D., Taylor L. R., Wilson D. R., Darlington G. J.
RT Impaired energy homeostasis in C/EBPalpha knockout mice
RL Science 269:1108-1112 (1995).
RN [21]; RE0011717.
RX PUBMED: 7822291.
RA Dougald O. A. Mac, Cornelius P., Liu R., Lane M. D.
RT Insulin regulates transcription of the CCAAT/Enhancer binding protein (C/EBP) alpha, beta and delta genes in fully-differentiated 3T3-L1 adipocytes
RL J. Biol. Chem. 270:647-654 (1995).
RN [22]; RE0016572.
RX PUBMED: 1592265.
RA Milos P. M., Zaret K. S.
RT A ubiquitous factor is required for C/EBP-related proteins to form stable transcription complexes on an albumin promoter segment in vitro.
RL Genes Dev. 6:991-1004 (1992).
RN [23]; RE0023877.
RX PUBMED: 12606546.
RA Yang T. T., Chow C. W.
RT Transcription cooperation by NFAT.C/EBP composite enhancer complex.
RL J. Biol. Chem. 278:15874-15885 (2003).
RN [24]; RE0034223.
RX PUBMED: 8855267.
RA Ford A. M., Bennett C. A., Healy L. E., Towatari M., Greaves M. F., Enver T.
RT Regulation of the myeloperoxidase enhancer binding proteins Pu1, C-EBP alpha, -beta, and -delta during granulocyte-lineage specification.
RL Proc. Natl. Acad. Sci. USA 93:10838-43 (1996).
RN [25]; RE0041178.
RX PUBMED: 12511558.
RA Subramanian L., Benson M. D., Iniguez-Lluhi J. A.
RT A synergy control motif within the attenuator domain of CCAAT/enhancer-binding protein alpha inhibits transcriptional synergy through its PIASy-enhanced modification by SUMO-1 or SUMO-3
RL J. Biol. Chem. 278:9134-41 (2003).
RN [26]; RE0047660.
RX PUBMED: 12727880.
RA Wiper-Bergeron N., Wu D., Pope L., Schild-Poulter C., Hache R. J.
RT Stimulation of preadipocyte differentiation by steroid through targeting of an HDAC1 complex.
RL EMBO J. 22:2135-2145 (2003).
XX
//