TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T02026 XX ID T02026 XX DT 19.12.1996 (created); hiwi. DT 16.10.2009 (updated); pro. CO Copyright (C), QIAGEN. XX FA C/EBPalpha(p30) XX SY C/EBPalpha(p30); C/EBPalpha-29(chicken); p30(C/EBPalpha); p30C/EBPalpha. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G000490 Cebpa. XX CL C0008; bZIP. XX SZ 242 AA; 25.6 kDa (cDNA) (calc.), 30 kDa (SDS) [2] [1] XX SQ MSAGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLF SQ PYQPPPPPPPPHPHASPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHAAPAL SQ GAAGLPGPGSALKGLAGAHPDLRTGGGGGGSGAGAGKAKKSVDKNSNEYRVRRERNNIAV SQ RKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGN SQ CA XX SC edited Swiss-Prot #P53566 XX FT 164 228 SM00338; brlzneu. FT 165 218 PF07716; Basic region leucine zipper. FT 166 229 PS50217; BZIP. XX SF alternative translation initiation product is C/EBPalpha (p42 variant) T00104 [1] [2]; XX CP (liver); A4 and WEHI 3BD cells [3]. XX FF activator, less efficient than full-length C/EBPalpha since it lacks the main trans-activating domain [1]; FF in contrast to C/EBPalpha, it does not inhibit cell proliferation [1]; FF LPS also reduces levels of C/EBPalpha(p30) protein in liver, but raises that of a 20 kDa isoform probably due to shifting translation to another AUG codon [2]; XX MX M00116 V$CEBPA_01. MX M07037 V$CEBPA_Q4. MX M01866 V$CEBPA_Q6. MX M00159 V$CEBP_01. MX M00201 V$CEBP_C. MX M00190 V$CEBP_Q2. MX M00912 V$CEBP_Q2_01. MX M00770 V$CEBP_Q3. MX M00249 V$CHOP_01. XX DR TRANSPATH: MO000026105. DR EMBL: M62362; DR UniProtKB: P53566; XX RN [1]; RE0003173. RX PUBMED: 8415748. RA Lin F.-T., MacDougald O.A., Diehl A.M., Lane M.D. RT A 30-kDa alternative translation product of the CCAAT/enhancer binding protein alpha message: Transcriptional activator lacking antimitotic activity RL Proc. Natl. Acad. Sci. USA 90:9606-9610 (1993). RN [2]; RE0006628. RX PUBMED: 8628296. RA An M. R., Hsieh C.-C., Reisner P. D., Rabek J. P., Scott S. G., Kuninger D. T., Papaconstantinou J. RT Evidence for posttranscriptional regulation of C/EBPalpha and C/EBPbeta isoform expression during the lipopolysaccharide-mediated acute-phase response RL Mol. Cell. Biol. 16:2295-2306 (1996). RN [3]; RE0034223. RX PUBMED: 8855267. RA Ford A. M., Bennett C. A., Healy L. E., Towatari M., Greaves M. F., Enver T. RT Regulation of the myeloperoxidase enhancer binding proteins Pu1, C-EBP alpha, -beta, and -delta during granulocyte-lineage specification. RL Proc. Natl. Acad. Sci. USA 93:10838-43 (1996). XX //