AC T00017
AS T05501.
XX
ID T00017
XX
DT 23.11.1992 (created); ewi.
DT 22.12.2014 (updated); ros.
CO Copyright (C), QIAGEN.
XX
FA C/EBPbeta-FL
XX
SY AGP/EBP; ANF-2; C/EBP beta; C/EBP-beta; C/EBPbeta; C/EBPbeta(p35); CCAAT Enhancer Binding Protein beta; CCAAT/enhance binding protein beta; CEBPB; CRP2; H-APF-2; IL-6DBP; interleukin-6-dependent binding protein; LAP; LAP1; liver-enriched activator protein; liver-enriched transcriptional activator; NF-IL6; NF-M; p35(C/EBPbeta); p35C/EBPbeta.
XX
OS mouse, Mus musculus
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae
XX
GE G005928 Cebpb.
XX
CL C0008; bZIP.
XX
SZ 296 AA; 31.4 kDa (cDNA) (calc.), 35 kDa (SDS) [13]
XX
SQ MHRLLAWDAACLPPPPAAFRPMEVANFYYEPDCLAYGAKAARAAPRAPAAEPAIGEHERA
SQ IDFSPYLEPLAPAADFAAPAPAHHDFLSDLFADDYGAKPSKKPADYGYVSLGRAGAKAAP
SQ PACFPPPPPAALKAEPGFEPADCKRADDAPAMAAGFPFALRAYLGYQATPSGSSGSLSTS
SQ SSSSPPGTPSPADAKAAPAACFAGPPAAPAKAKAKKTVDKLSDEYKMRRERNNIAVRKSR
SQ DKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASAGHC
XX
SC Swiss-Prot#P28033
XX
FT 220 284 
SM00338; brlzneu.
FT 221 274 
PF07716; Basic region leucine zipper.
FT 222 285 
PS50217; BZIP.
FT 276 276 
Ser-phosphorylation [3].
XX
SF there are at least two isoforms C/EBPbeta-FL T00017 and C/EBPbeta(p20) T02360 [13];
SF the leucine zipper motif may interact with the Rel-domain of NF-kappaB1 (p50) thus causing synergistic regulation by two factors [11];
SF the leucine zipper motif may interact with the DNA-binding domain of the estrogen receptor leading to an inhibition of C/EBPbeta activity [10];
XX
CP ubiquitous.
XX
FF Phosphorylation of C/EBP-beta at T188 is required to induce expression of C/EBP-alpha T00104 as well as adiponectin T09518 [24];
FF activator [6] [20];
FF may enhance activation by glucocorticoids [6];
FF expressed very early during adipocyte differentiation, can be induced by adipogenic hormones;
FF expression declines before onset of C/EBPalpha accumulation [4];
FF insulin transiently induces C/EBPbeta in fully-differentiated adipocytes [14];
FF phosphorylated in pituitary cells by a calcium-calmodulin-dependent protein kinase at Ser-276 [3];
FF required for bactericidal and tumoricidal activities of macrophages [9];
FF required for correct T-helper cell function and for correct humoral, innate and cellular immunity in general [12];
FF protein levels in liver are not affected by LPS [13];
FF DNA-binding to the p21 promoter seems to be induced by PKA-mediated phosphorylation of C/EBPbeta at Ser299 resulting in nuclear translocation [18];
FF interacts with NF-ATc2 in adipocytes [19];
FF interacts with SRF [20];
XX
IN T01303 ATF-4; human, Homo sapiens.
IN T00122 c-Fos; mouse, Mus musculus.
IN T00104 C/EBPalpha-isoform1; mouse, Mus musculus.
IN T00108 C/EBPalpha-isoform1; rat, Rattus norvegicus.
IN T00105 C/EBPalpha; human, Homo sapiens.
IN T00017 C/EBPbeta-FL; mouse, Mus musculus.
IN T00109 C/EBPdelta; rat, Rattus norvegicus.
IN T00583 C/EBPdelta; human, Homo sapiens.
IN T01114 C/EBPdelta; mouse, Mus musculus.
IN T00216 C/EBPgamma; mouse, Mus musculus.
IN T00127 CHOP-10; mouse, Mus musculus.
IN T09171 hnRNPK; rat, Rattus norvegicus.
IN T01944 NFATc2; mouse, Mus musculus.
XX
MX M00109 V$CEBPB_01.
MX M00117 V$CEBPB_02.
MX M07315 V$CEBPB_Q3.
MX M01896 V$CEBPB_Q6.
MX M00912 V$CEBP_Q2_01.
MX M00770 V$CEBP_Q3.
XX
BS R00207.
BS R04575.
BS R04912.
BS R02170.
BS R00238.
BS R73941.
BS R04047.
BS R14487.
BS R03136.
BS R08097.
BS R08098.
BS R08099.
BS R08100.
BS R03135.
BS R28012.
BS R14479.
BS R08130.
BS R02460.
BS R02461.
BS R02457.
BS R02216.
BS R13282.
BS R03414.
BS R08089.
BS R08090.
BS R01344.
XX
DR TRANSPATH: MO000002639.
DR TRANSCOMPEL: C00153.
DR TRANSCOMPEL: C00154.
DR EMBL: M61007;
DR EMBL: S78572;
DR EMBL: X62600;
DR UniProtKB: P28033;
XX
RN [1]; RE0000742.
RX PUBMED: 1884998.
RA Williams S. C., Cantwell C. A., Johnson P. F.
RT A family of C/EBP-related proteins capable of forming covalently linked leucine zipper dimers in vitro
RL Genes Dev. 5:1553-1567 (1991).
RN [2]; RE0001539.
RX PUBMED: 1701020.
RA Chang C.-J., Chen T.-T., Lei H.-Y., Chen D.-Sh., Lee Sh.-Ch.
RT Molecular cloning of a transcription factor, AGP/EBP, that belongs to members of the C/EBP family
RL Mol. Cell. Biol. 10:6642-6653 (1990).
RN [3]; RE0002681.
RX PUBMED: 1314426.
RA Wegner M., Cao Z., Rosenfeld M. G.
RT Calcium-regulated phosphorylation within the leucine zipper of C/EBPbeta
RL Science 256:370-373 (1992).
RN [4]; RE0002732.
RX PUBMED: 1840554.
RA Cao Z., Umek R. M., McKnight S. L.
RT Regulated expression of three C/EBP isoforms during adipose conversion of 3T3-L1 cells
RL Genes Dev. 5:1538-1552 (1991).
RN [5]; RE0003023.
RX PUBMED: 1371993.
RA Alam T., An M. R., Papaconstantinou J.
RT Differential expression of three C/EBP isoforms in multiple tissues during the acute phase response
RL J. Biol. Chem. 267:5021-5024 (1992).
RN [6]; RE0003028.
RX PUBMED: 1382074.
RA Baumann H., Morella K. K., Campos S. P., Cao Z., Jahreis G. P.
RT Role of CAAT-enhancer binding protein isoforms in the cytokine regulation of acute-phase plasma protein genes
RL J. Biol. Chem. 267:19744-19751 (1992).
RN [7]; RE0003032.
RX PUBMED: 8196668.
RA Ray A., Ray B. K.
RT Serum amyloid A gene expression under acute-phase conditions involves participation of inducible C/EBP-beta and C/EBP-delta and their activation by phosphorylation
RL Mol. Cell. Biol. 14:4324-4332 (1994).
RN [8]; RE0003040.
RX PUBMED: 8506317.
RA Vallejo M., Ron D., Miller C. P., Habener J. F.
RT C/ATF, a member of the activating transcription factor family of DNA-binding proteins, dimerizes with CAAT/enhancer-binding proteins and directs their binding to cAMP response elements
RL Proc. Natl. Acad. Sci. USA 90:4679-4683 (1993).
RN [9]; RE0003539.
RX PUBMED: 7530603.
RA Tanaka T., Akira S., Yoshida K., Umemoto M., Yoneda Y., Shirafuji N., Fujiwara H., Suematsu S., Yoshida N., Kishimoto T.
RT Targeted disruption of the NF-IL6 gene discloses its essential role in bacteria killing and tumor cytotoxicity by macrophages
RL Cell 80:353-361 (1995).
RN [10]; RE0004503.
RX PUBMED: 7651415.
RA Stein B., Yang M. X.
RT Repression of the interleukin-6 promoter by estrogen receptor is mediated by NF-kappaB and C/EBPbeta
RL Mol. Cell. Biol. 15:4971-4979 (1995).
RN [11]; RE0004524.
RX PUBMED: 8321203.
RA Stein B., Cogswell P. C., Baldwin jr A. S.
RT Functional and physical associations between NF-kappaB and C/EBP family members: a Rel domain-bZIP interaction
RL Mol. Cell. Biol. 13:3964-3974 (1993).
RN [12]; RE0006256.
RX PUBMED: 7744000.
RA Screpanti I., Romani L., Musiani P., Modesti A., Fattori E., Lazzaro D., Sellitto C., Scarpa S., Bellavia D., Lattanzio G., Bistoni F., Frati L., Cortese R., Gulino A., Ciliberto G., Constantini F., Poli V.
RT Lymphoproliferative disorder and imbalanced T-helper response in C/EBPbeta- deficient mice
RL EMBO J. 14:1932-1941 (1995).
RN [13]; RE0006628.
RX PUBMED: 8628296.
RA An M. R., Hsieh C.-C., Reisner P. D., Rabek J. P., Scott S. G., Kuninger D. T., Papaconstantinou J.
RT Evidence for posttranscriptional regulation of C/EBPalpha and C/EBPbeta isoform expression during the lipopolysaccharide-mediated acute-phase response
RL Mol. Cell. Biol. 16:2295-2306 (1996).
RN [14]; RE0011717.
RX PUBMED: 7822291.
RA Dougald O. A. Mac, Cornelius P., Liu R., Lane M. D.
RT Insulin regulates transcription of the CCAAT/Enhancer binding protein (C/EBP) alpha, beta and delta genes in fully-differentiated 3T3-L1 adipocytes
RL J. Biol. Chem. 270:647-654 (1995).
RN [15]; RE0018254.
RX PUBMED: 12037571.
RA Ge K., Guermah M., Yuan C. X., Ito M., Wallberg A. E., Spiegelman B. M., Roeder R. G.
RT Transcription coactivator TRAP220 is required for PPAR gamma 2-stimulated adipogenesis.
RL Nature 417:563-567 (2002).
RN [16]; RE0020257.
RX PUBMED: 7598808.
RA CHANG C.J., SHEN B.J., LEE S.C.
RT Autoregulated induction of the acute-phase response transcription factor gene, agp/ebp.
RL DNA Cell Biol. 14:529-537 (1995).
RN [17]; RE0022767.
RX PUBMED: 11278638.
RA Piwien-Pilipuk G., Van Mater D., Ross S. E., MacDougald O. A., Schwartz J.
RT Growth hormone regulates phosphorylation and function of CCAAT/enhancer-binding protein beta by modulating Akt and glycogen synthase kinase-3.
RL J. Biol. Chem. 276:19664-19671 (2001).
RN [18]; RE0022769.
RX PUBMED: 9374525.
RA Chinery R., Brockman J. A., Dransfield D. T., Coffey R. J.
RT Antioxidant-induced nuclear translocation of CCAAT/enhancer-binding protein beta. A critical role for protein kinase A-mediated phosphorylation of Ser299.
RL J. Biol. Chem. 272:30356-30361 (1997).
RN [19]; RE0023877.
RX PUBMED: 12606546.
RA Yang T. T., Chow C. W.
RT Transcription cooperation by NFAT.C/EBP composite enhancer complex.
RL J. Biol. Chem. 278:15874-15885 (2003).
RN [20]; RE0025197.
RX PUBMED: 9032301.
RA Sealy L., Malone D., Pawlak M.
RT Regulation of the cfos serum response element by C/EBPbeta.
RL Mol. Cell. Biol. 17:1744-1755 (1997).
RN [21]; RE0047990.
RX PUBMED: 9553145.
RA Miau L. H., Chang C. J., Shen B. J., Tsai W. H., Lee S. C.
RT Identification of heterogeneous nuclear ribonucleoprotein K (hnRNP K) as a repressor of C/EBPbeta-mediated gene activation.
RL J. Biol. Chem. 273:10784-10791 (1998).
RN [22]; RE0047996.
RX PUBMED: 15985551.
RA Tang Q. Q., Gronborg M., Huang H., Kim J. W., Otto T. C., Pandey A., Lane M. D.
RT Sequential phosphorylation of CCAAT enhancer-binding protein beta by MAPK and glycogen synthase kinase 3beta is required for adipogenesis.
RL Proc. Natl. Acad. Sci. USA 102:9766-9771 (2005).
RN [23]; RE0048226.
RX PUBMED: 10635333.
RA Buck M., Poli V., van der Geer P., Chojkier M., Hunter T.
RT Phosphorylation of rat serine 105 or mouse threonine 217 in C/EBP beta is required for hepatocyte proliferation induced by TGF alpha.
RL Mol. Cell 4:1087-1092 (1999).
RN [24]; RE0048573.
RX PUBMED: 15367685.
RA Park B. H., Qiang L., Farmer S. R.
RT Phosphorylation of C/EBP beta at a consensus extracellular signal regulated kinase/ glycogen synthase kinase 3 site is required for the induction of adiponectin gene expression during the differentiation of mouse fibroblasts into adipocytes
RL Mol. Cell. Biol. 24:8671-8680 (2004).
RN [25]; RE0049611.
RX PUBMED: 17110376.
RA Cesena T. I., Cardinaux J. R., Kwok R., Schwartz J.
RT CCAAT/enhancer-binding protein (C/EBP) beta is acetylated at multiple lysines: acetylation of C/EBPbeta at lysine 39 modulates its ability to activate transcription.
RL J. Biol. Chem. 282:956-967 (2007).
XX
//