TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T02360 XX ID T02360 XX DT 05.03.1998 (created); ewi. DT 12.02.2015 (updated); pro. CO Copyright (C), QIAGEN. XX FA C/EBPbeta-LIP XX SY C/EBPbeta(p20); LIP; liver-enriched inhibitory protein; p20(C/EBPbeta); p20C/EBPbeta. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G005928 Cebpb. XX CL C0008; bZIP. XX SZ 145 AA; 15.6 kDa (cDNA) (calc.), 20 kDa (SDS) [1] XX SQ MAAGFPFALRAYLGYQATPSGSSGSLSTSSSSSPPGTPSPADAKAAPAACFAGPPAAPAK SQ AKAKKTVDKLSDEYKMRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQL SQ SRELSTLRNLFKQLPEPLLASAGHC XX SC edited Swiss-Prot #P28033 XX FT 69 133 SM00338; brlzneu. FT 70 123 PF07716; Basic region leucine zipper. FT 71 134 PS50217; BZIP. XX SF there are at least two isoforms C/EBPbeta(p35) T00017 and C/EBPbeta-LIP T02360 [1]; SF lacks the transactivation domain which is present in the p35 splice variant; XX CP (liver). EX mouse, Mus musculus,,,embryo; detectable; Western blot; protein; [3]. XX FF repressor; FF can block c-fos induction by serum [2]; FF strongly induced in liver by LPS [1]; XX IN T17789 ATF-5; Mammalia. XX MX M00109 V$CEBPB_01. MX M00117 V$CEBPB_02. MX M07315 V$CEBPB_Q3. MX M01896 V$CEBPB_Q6. MX M00912 V$CEBP_Q2_01. MX M00770 V$CEBP_Q3. XX BS R04047. BS R29474. BS R66205. BS R66209. XX DR TRANSPATH: MO000026350. DR UniProtKB: P28033; XX RN [1]; RE0006628. RX PUBMED: 8628296. RA An M. R., Hsieh C.-C., Reisner P. D., Rabek J. P., Scott S. G., Kuninger D. T., Papaconstantinou J. RT Evidence for posttranscriptional regulation of C/EBPalpha and C/EBPbeta isoform expression during the lipopolysaccharide-mediated acute-phase response RL Mol. Cell. Biol. 16:2295-2306 (1996). RN [2]; RE0025197. RX PUBMED: 9032301. RA Sealy L., Malone D., Pawlak M. RT Regulation of the cfos serum response element by C/EBPbeta. RL Mol. Cell. Biol. 17:1744-1755 (1997). RN [3]; RE0022767. RX PUBMED: 11278638. RA Piwien-Pilipuk G., Van Mater D., Ross S. E., MacDougald O. A., Schwartz J. RT Growth hormone regulates phosphorylation and function of CCAAT/enhancer-binding protein beta by modulating Akt and glycogen synthase kinase-3. RL J. Biol. Chem. 276:19664-19671 (2001). XX //