TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01944 XX ID T01944 XX DT 18.11.1996 (created); ewi. DT 15.01.2016 (updated); mkl. CO Copyright (C), QIAGEN. XX FA NFATc2 XX SY NF-AT1; NF-ATc2; NF-ATp; NF-IL2E; NFAT1; NFATC2; NFATp; NFII-a; Nuclear Factor of Activated T-cells p. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G005448 Nfatc2. XX CL C0052; REL/NFAT. XX SZ 1064 AA; 115.0 kDa (cDNA) (calc.), 120 kDa (SDS) [16] [15] XX SQ MDVPEPQPDPDGGDGPGHEPGGSPQDELDFSILFDYDYLNPIEEEPIAHKAISSPSGLAY SQ PDDVLDYGLKPCNPLASLSGEPPGRFGEPDSIGFQNFLSPVKPAGASGPSPRIEITPSHE SQ LMQAGGALRGRDAGLSPEQPALALAGVAASPRFTLPVPGYEGYREPLCLSPASSGSSASF SQ ISDTFSPYTSPCVSPNNAGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPV SQ PRPASRSSSPGAKRRHSCAEALVAPLPAASPQRSRSPSPQPSPHVAPQDDSIPAGYPPTA SQ GSAVLMDALNTLATDSPCGIPSKIWKTSPDPTPVSTAPSKAGLARHIYPTVEFLGPCEQE SQ ERRNSAPESILLVPPTWPKQLVPAIPICSIPVTASLPPLEWPLSNQSGSYELRIEVQPKP SQ HHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHR SQ ITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRK SQ NTRVRLVFRVHVPEPSGRIVSLQAASNPIECSQRSAHELPMVERQDMDSCLVYGGQQMIL SQ TGQNFTAESKVVFMEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRVPVKVNF SQ YVINGKRKRSQPQHFTYHPVPAIKTEPSDEYEPSLICSPAHGGLGSQPYYPQHPMLAESP SQ SCLVATMAPCQQFRSGLSSPDARYQQQSPAAALYQRSKSLSPGLLGYQQPSLLAAPLGLA SQ DAHRSVLVHAGSQGQGQGSTLRHTSSASQQASPVIHYSPTNQQLRGGGHQEFQHIMYCEN SQ FGPSSARPGPPPINQGQRLSPGAYPTVIQQQTAPSQRAAKNGPSDQKEALPTGVTVKQEQ SQ NLDQTYLDDAATSESWVGTERYIERKFWKKTLVQPGLLPSFLLLGSLSAGPRSQTPSERK SQ PIEEDVPLSCSQIAWCCQHPLGTCPVLPGPLAVEWWEGQLGRGLEPIPWAPDSAGSLHEV SQ DSVGLAGVVGMVLLTLMHHFSMDQNQTPSPHWQRHKEVASPGWI XX SC translated from EMBL #U02079 XX FT 110 116 calcineurin binding [18]. FT 170 183 serine-rich region 1 (7/14) [18]. FT 186 202 serine-/proline-rich region 1 (7/17) [18]. FT 215 231 serine-/proline-rich region 2 (7/17) [18]. FT 224 410 minimal DNA-binding domain [8]. FT 245 250 serine-rich region 2 (4/6) [18]. FT 253 255 NLS [18]. FT 270 290 serine-/proline-rich region 3 (11/21) [18]. FT 394 576 PS50254; REL_2. FT 412 572 PF00554; Rel homology domain (RHD). FT 522 940 PF00478; IMP dehydrogenase / GMP reductase domain. FT 579 678 SM00429; iptmega2. FT 580 678 PF01833; IPT/TIG domain. XX SF at least three splice variants in T-cells [15]; SF the Rel-homology is relatively low, but significant [8]; SF together with AP-1, it constitutes the DNA-binding activity NF-AT [11] [13] [14] [15] [16] [5]; SF interacts with c-Jun homodimers and with c-Fos/c-Jun heterodimers through the leucine zipper domains of both polypeptides and additionally using an acidic region of c-Fos [16] [17]; SF in activated T-cells, holo-NF-AT formed at the IL-2 gene contains Fra-1/JunB heterodimers, but neither JunD, c-Fos, or FosB [14]; XX CP activated T cells [15], stimulated and nonstimulated thymus and spleen, brain, heart, skin, testis [10]; pancreatic islet alpha cells [19]; [19] [10] [15]. CN kidney, liver, lung, muscle, ovary [10]. XX FF activator; FF NF-ATp is the primary DNA-binding determinant within the NF-AT complex at the IL-2 gene [15]; FF upon T-cell activation, NF-ATp is dephosphorylated by calcineurin, probably as a prerequisite for nuclear translocation [13] [16]; FF immunosuppressive drugs inhibiting calcineurin (cyclosporin A and FK506) block nuclear translocation of NF-ATp [9] [6] [4]; FF no induction by TPA and ionomycin [10]; FF dephosphorylation of NF-ATp masks a NES and exposes the NLS [18]; FF in pancreatic islet cells, is activated by calcineurin in response to depolarization-induced calcium influx [19]; FF serves to provide a particular orientation of Jun-Fos heterodimers on DNA in Jun-Fos-NFAT-DNA complexes [21] [22]; FF in adipocytes, interacts with C/EBPalpha and C/EBPbeta [20]; XX IN T00104 C/EBPalpha-isoform1; mouse, Mus musculus. IN T00017 C/EBPbeta-FL; mouse, Mus musculus. XX MX M03555 V$NFAT1_Q4. MX M07365 V$NFAT1_Q5. MX M01281 V$NFAT1_Q6. MX M07608 V$NFAT_Q3. MX M00935 V$NFAT_Q4_01. MX M00302 V$NFAT_Q6. XX BS R05034. BS R05082. BS R05089. BS R05090. BS R05091. BS R05092. BS R05094. BS R13414. BS R24088. BS R24089. BS R05054. BS R05055. BS R05072. BS R08170. BS R08171. BS R14628. BS R14629. BS R14630. BS R14631. BS R03186. BS R08188. BS R27426. BS R14475. BS R29747. BS R29750. BS R02348. BS R02349. BS R02952. BS R02953. BS R05049. BS R05051. BS R05053. BS R73940. BS R04775. BS R05080. BS R05081. BS R05097. BS R14662. BS R02210. BS R13436. XX DR TRANSPATH: MO000026042. DR TRANSCOMPEL: C00141. DR TRANSCOMPEL: C00142. DR TRANSCOMPEL: C00143. DR TRANSCOMPEL: C00144. DR TRANSCOMPEL: C00149. DR TRANSCOMPEL: C00150. DR TRANSCOMPEL: C00151. DR TRANSCOMPEL: C00159. DR TRANSCOMPEL: C00164. DR TRANSCOMPEL: C00167. DR EMBL: U02079; DR UniProtKB: Q60591-1; XX RN [1]; RE0000460. RX PUBMED: 2369902. RA Randak C., Brabletz T., Hergenroether M., Sobotta I., Serfling E. RT Cyclosporin A suppresses the expression of the interleukin 2 gene by inhibiting the binding of lymphocyte-specific factors to the IL-2 enhancer RL EMBO J. 9:2529-2536 (1990). RN [2]; RE0000685. RX PUBMED: 2123468. RA Fiering S., Northrop J. P., Nolan G. P., Mattila P. S., Crabtree G. R., Herzenberg L. A. RT Single cell assay of a transcription factor reveals a threshold in transcription activated by signals emanating from the T-cell antigen receptor RL Genes Dev. 4:1823-1834 (1990). RN [3]; RE0001660. RX PUBMED: 1712901. RA Banerji S. S., Parsons J. N., Tocci M. J. RT The immunosuppressant FK-506 specifically inhibits mitogen-induced activation of the interleukin-2 promoter and the isolated enhancer elements NFIL-2A and NF-AT1 RL Mol. Cell. Biol. 11:4074-4087 (1991). RN [4]; RE0001931. RX PUBMED: 1715516. RA Flanagan W. M., Corthesy B., Bram R. J., Crabtree G. R. RT Nuclear association of a T-cell transcription factor blocked by FK-506 and cyclosporin A RL Nature 352:803-807 (1991). RN [5]; RE0001934. RX PUBMED: 1533441. RA Jain J., McCaffrey P. G., Valge-Archer V. E., Rao A. RT Nuclear factor of activated T cells contain Fos and Jun RL Nature 356:801-804 (1992). RN [6]; RE0002139. RX PUBMED: 1707162. RA Brabletz T., Pietrowski I., Serfling E. RT The immunosuppressives FK 506 and cyclosporin A inhibit the generation of protein factors binding to the two purine boxes of the interleukin 2 enhancer RL Nucleic Acids Res. 19:61-67 (1991). RN [7]; RE0002645. RX PUBMED: 2595372. RA Emmel E. A., Verweij C. L., Durand D. B., Higgins K. M., Lacy E., Crabtree G. R. RT Cyclosporin A specifically inhibits function of nuclear proteins involved in T cell activation RL Science 246:1617-1620 (1989). RN [8]; RE0003842. RX PUBMED: 7876165. RA Jain J., Burgeon E., Badalian T. M., Hogan P. G., Rao A. RT A similar DNA-binding motif in NFAT family proteins and the Rel homolgy region RL J. Biol. Chem. 270:4138-4145 (1995). RN [9]; RE0004483. RX PUBMED: 1702384. RA Mattila P. S., Ullman K. S., Fiering S., Emmel E. A., McCutcheon M., Crabtree G. R., Herzenberg L. A. RT The actions of cyclosporin A and FK506 suggest a novel step in the activation of T lymphocytes RL EMBO J. 9:4425-4433 (1990). RN [10]; RE0004486. RX PUBMED: 8202141. RA Northrop J. P., Ho S. N., Chen L., Thomas D. J., Timmerman L. A., Nolan G. P., Admon A., Crabtree G. R. RT NF-AT components define a family of transcription factors targeted in T-cell activation RL Nature 369:497-502 (1994). RN [11]; RE0004625. RX PUBMED: 8428966. RA Northrop J. P., Ullman K. S., Crabtree G. R. RT Characterization of the nuclear and cytoplasmic components of the lymphoid-specific nuclear factor of activated T cells (NF-AT) complex RL J. Biol. Chem. 268:2917-2923 (1993). RN [12]; RE0004626. RX PUBMED: 8436291. RA Ullman K. S., Northrop J. P., Admon A., Crabtree G. R. RT Jun family members are controlled by a calcium-regulated, cyclosporin A-sensitive signaling pathway in activated T lymphocytes RL Genes Dev. 7:188-196 (1993). RN [13]; RE0004627. RX PUBMED: 7679116. RA McCaffrey P. G., Perrino B. A., Soderling T. R., Rao A. RT NF-ATp, a T lymphocyte DNA-binding protein that is a target for calcineurin and immunosuppressive drugs RL J. Biol. Chem. 268:3747-3752 (1993). RN [14]; RE0004628. RX PUBMED: 8441422. RA Boise L., Petryniak B., Mao X., June C. H., Wang C.-Y., Lindsten T., Bravo R., Kovary K., Leiden J., Thompson C. B. RT The NFAT-1 DNA binding complex in activated T cells contains Fra-1 and JunB RL Mol. Cell. Biol. 13:1911-1919 (1993). RN [15]; RE0004629. RX PUBMED: 8235597. RA McCaffrey P. G., Luo C., Kerpolla T. K., Jain J., Badalian T. M., Ho A. M., Burgeon E., Lane W. S., Lambert J. N., Curran T., Verdine G. L., Rao A., Hogan P. G. RT Isolation of the cyclosporin-sensitive T cell transcription factor NFATp RL Science 262:750-754 (1993). RN [16]; RE0004630. RX PUBMED: 8397339. RA Jain J., McCaffrey P. G., Miner Z., Kerpolla T. K., Lambert J. N., Verdine G. L., Curran T., Rao A. RT The T-cell transcription factor NFATp is a substrate for calcineurin and interacts with Fos and Jun RL Nature 365:352-355 (1993). RN [17]; RE0004631. RX PUBMED: 7935406. RA Yaseen N. R., Park J., Kerppola T., Curran T., Sharma S. RT A central role for Fos in human B- and T-cell NFAT (nuclear factor of activated T cells): an acidic region is required for in vitro assembly RL Mol. Cell. Biol. 14:6886-6895 (1994). RN [18]; RE0017929. RX PUBMED: 11030334. RA Okamura H., Aramburu J., Garcia-Rodriguez C., Viola J. P., Raghavan A., Tahiliani M., Zhang X., Qin J., Hogan P. G., Rao A. RT Concerted dephosphorylation of the transcription factor NFAT1 induces a conformational switch that regulates transcriptional activity. RL Mol. Cell 6:539-550 (2000). RN [19]; RE0022875. RX PUBMED: 10026208. RA Furstenau U., Schwaninger M., Blume R., Jendrusch E. M., Knepel W. RT Characterization of a novel calcium response element in the glucagon gene. RL J. Biol. Chem. 274:5851-5860 (1999). RN [20]; RE0023877. RX PUBMED: 12606546. RA Yang T. T., Chow C. W. RT Transcription cooperation by NFAT.C/EBP composite enhancer complex. RL J. Biol. Chem. 278:15874-15885 (2003). RN [21]; RE0023932. RX PUBMED: 11320240. RA Ramirez-Carrozzi V. R., Kerppola T. K. RT Dynamics of Fos-Jun-NFAT1 complexes. RL Proc. Natl. Acad. Sci. USA 98:4893-4898 (2001). RN [22]; RE0023933. RX PUBMED: 11259418. RA Ramirez-Carrozzi V. R., Kerppola T. K. RT Control of the orientation of Fos-Jun binding and the transcriptional cooperativity of Fos-Jun-NFAT1 complexes. RL J. Biol. Chem. 276:21797-21808 (2001). XX //