AC T00108
XX
ID T00108
XX
DT 15.10.1992 (created); ewi.
CO Copyright (C), QIAGEN.
XX
FA C/EBPalpha-isoform1
XX
SY BPc; C/EBP; C/EBP alpha; C/EBPalpha; CBP; CCAAT/enhancer binding protein alpha; CEBPA; EBP20; LF-H3beta.
XX
OS rat, Rattus norvegicus
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae
XX
GE G001192 Cebpa.
XX
CL C0008; bZIP.
XX
SZ 358 AA; 37.7 kDa (cDNA) (calc.), 42 kDa (SDS) [33] [5]
XX
SQ MESADFYEAEPRPPMSSHLQSPPHAPSNARLWLSPGRGPRAAPSPTCRPGAAGRICEHET
SQ SIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAAGPAGGGGDFDYPGAPAGPGGAVMSA
SQ GAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQ
SQ PPPPPPPPHPHASPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPAMGAA
SQ GLPGPGGSLKGLAGPHPDLRTGGGGGGGAGAGKAKKSVDKNSNEYRVRRERNNIAVRKSR
SQ DKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA
XX
SC Swiss-Prot#P05554
XX
FT 1 117 
missing in p30(C/EBPalpha) [38].
FT 15 15 
alternative translation initiation codon [38].
FT 69 97 
trans-activation domain, potential alpha-helix, region 3 [9].
FT 107 170 
attenuator domain [20].
FT 118 118 
alternative translation initiation codon [38].
FT 280 344 
SM00338; brlzneu.
FT 281 334 
PF07716; Basic region leucine zipper.
FT 282 345 
PS50217; BZIP.
FT 299 299 
Ser-phosphorylation by PKC [34].
XX
SF scissors-grip and helical-fork models for DNA-binding;
SF scissors grip: upon DNA-binding, the alpha-helices of the two leucine zippers extend towards the basic regions which make the DNA- contacts [25];
SF as a result, dissociation constant for homodimerization increases from KD = 10 nM to KD = 1 nM in the presence of DNA [43];
SF a kink has been postulated between basic subregions A and B at the conserved Asn-292, allowing to track the basic region in the major groove around the DNA double helix [25];
SF proteolytically sensitive sites between basic subregions A and B and between basic region and the leucine zipper [28];
SF helical-fork: similar to scissors-grip model, but the basic region forms an extended rather than a kinked alpha-helix [39];
SF highly relaxed DNA-binding specificity [22] [16];
SF Y285, N293, and V296 determine the DNA-binding specificity over that of GCN4 [21];
SF the "hinge region" at the end of the basic region and the beginning of the leucine zipper (303-317) defines the spatial relation between the half-sites of the bound DNA sequence [21];
SF the mid-regional trans-activating region consists of redundant modules [9];
SF the N-terminal part of the molecule exhibits antimitotic activity [38];
SF both TE-I and TE-II cooperatively mediate the contact to TBP and TFIIB [42];
XX
CP nonproliferating liver, adipose, small intestine, adrenal gland, placenta, lung, brain, skin [10]; low levels in muscle and thymus [3] [10] [3].
CN heart [10].
XX
FF activator [46] [6] [7];
FF required for and regulating the terminal adipocyte differentiation [37] [6] [27];
FF adipocyte differentiation reciprocally regulated by C/EBPalpha-isoform1 and c-myc [32];
FF expressed only in fully differentiated cells [10];
FF decreased levels in regenerating liver [35];
FF repressor at the genomes of HBV, SV40 [25];
FF significant enhancement of dimerization by Tax [29];
FF phosphorylation at S299 attenuates DNA-binding [34];
FF interaction of C/EBPalpha-isoform1 with FBR v-Fos inhibits C/EBPalpha-isoform1 and its effects to induce adipocyte differentiation and to repress the alpha(III) collagen gene [44];
XX
IN T01303 ATF-4; human, Homo sapiens.
IN T00051 ATF; human, Homo sapiens.
IN T00133 c-Jun; human, Homo sapiens.
IN T08461 c-Jun; human, Homo sapiens.
IN T00108 C/EBPalpha-isoform1; rat, Rattus norvegicus.
IN T00017 C/EBPbeta-FL; mouse, Mus musculus.
IN T00459 C/EBPbeta-FL; rat, Rattus norvegicus.
IN T00581 C/EBPbeta; human, Homo sapiens.
IN T00109 C/EBPdelta; rat, Rattus norvegicus.
IN T01114 C/EBPdelta; mouse, Mus musculus.
IN T00171 C/EBPepsilon; rat, Rattus norvegicus.
IN T00216 C/EBPgamma; mouse, Mus musculus.
IN T00127 CHOP-10; mouse, Mus musculus.
IN T09280 NeuroD; mouse, Mus musculus.
IN T08341 Sox-10-isoform1; human, Homo sapiens.
IN T08441 Sox-10; rat, Rattus norvegicus.
IN T14088 Sox-8; mouse, Mus musculus.
IN T09097 SRY; human, Homo sapiens.
IN T00794 TBP; human, Homo sapiens.
IN T02159 TFIIB; rat, Rattus norvegicus.
XX
MX M00116 V$CEBPA_01.
MX M07037 V$CEBPA_Q4.
MX M01866 V$CEBPA_Q6.
MX M00159 V$CEBP_01.
MX M00201 V$CEBP_C.
MX M00190 V$CEBP_Q2.
MX M00912 V$CEBP_Q2_01.
MX M00770 V$CEBP_Q3.
MX M00249 V$CHOP_01.
XX
BS R03153.
BS R00102.
BS R00103.
BS R00104.
BS R03906.
BS R39304.
BS R00207.
BS R07453.
BS R07454.
BS R07455.
BS R07456.
BS R07457.
BS R07458.
BS R07459.
BS R07460.
BS R07461.
BS R07462.
BS R07463.
BS R07464.
BS R07465.
BS R07466.
BS R07467.
BS R07468.
BS R07469.
BS R07470.
BS R07471.
BS R07472.
BS R07473.
BS R07474.
BS R08477.
BS R07681.
BS R07682.
BS R07683.
BS R07684.
BS R07685.
BS R07686.
BS R07687.
BS R07688.
BS R07689.
BS R07690.
BS R07691.
BS R07692.
BS R07693.
BS R07694.
BS R07695.
BS R07696.
BS R07697.
BS R07698.
BS R07699.
BS R07700.
BS R07701.
BS R07702.
BS R07703.
BS R07704.
BS R07705.
BS R07706.
BS R07707.
BS R07708.
BS R07709.
BS R07710.
BS R07711.
BS R07712.
BS R07713.
BS R07714.
BS R07715.
BS R07716.
BS R07717.
BS R07718.
BS R07719.
BS R02132.
BS R04246.
BS R04247.
BS R04592.
BS R04911.
BS R04603.
BS R00480.
BS R00631.
BS R00632.
BS R00635.
BS R00637.
BS R02056.
BS R02737.
BS R02739.
BS R02740.
BS R02743.
BS R02744.
BS R02745.
BS R02746.
BS R03246.
BS R03250.
BS R03251.
BS R03252.
BS R03128.
BS R03129.
BS R03130.
BS R03131.
BS R03234.
BS R03237.
BS R03239.
BS R03242.
BS R03243.
BS R03244.
BS R02459.
BS R01613.
BS R02468.
BS R16633.
BS R04476.
BS R04477.
BS R00422.
BS R03152.
BS R00627.
BS R00629.
BS R03068.
BS R03069.
BS R58240.
BS R13167.
BS R13168.
BS R13169.
BS R01456.
BS R01445.
BS R08115.
BS R00125.
BS R02042.
BS R02045.
BS R02046.
BS R00082.
BS R00083.
BS R00089.
BS R00090.
BS R00093.
BS R35378.
BS R35383.
BS R35384.
BS R08123.
BS R26031.
BS R01839.
BS R04498.
BS R00837.
BS R00847.
BS R02460.
BS R02461.
BS R02457.
BS R02458.
BS R08105.
BS R01841.
BS R01462.
BS R01463.
BS R01154.
BS R01156.
BS R01235.
BS R08119.
BS R08120.
BS R00111.
BS R03307.
BS R03310.
BS R61585.
BS R04515.
BS R04516.
BS R04517.
BS R04518.
BS R38576.
BS R04514.
BS R02564.
BS R66441.
BS R66448.
BS R21782.
BS R21783.
BS R21777.
BS R21778.
BS R08878.
BS R05074.
BS R23201.
BS R23202.
BS R23205.
BS R23206.
BS R23207.
BS R23208.
BS R23209.
BS R23210.
BS R23212.
BS R23213.
BS R23214.
BS R04494.
BS R08138.
BS R01217.
BS R01686.
BS R01688.
BS R01689.
BS R04662.
BS R08116.
BS R16332.
BS R08109.
BS R08110.
BS R02855.
BS R08106.
BS R08107.
BS R01358.
BS R03139.
BS R03141.
BS R03142.
BS R03143.
BS R03147.
BS R03148.
BS R03149.
BS R03151.
BS R30504.
BS R08135.
BS R08136.
BS R01314.
BS R01344.
BS R01408.
BS R02895.
XX
DR TRANSPATH: MO000002635.
DR EMBL: X12752;
DR UniProtKB: P05554;
XX
RN [1]; RE0000015.
RX PUBMED: 1993067.
RA McKeon C., Pham T.
RT Transactivation of the human insulin receptor gene by the CAAT/enhancer binding protein
RL Biochem. Biophys. Res. Commun. 174:721-728 (1991).
RN [2]; RE0000115.
RX PUBMED: 3004739.
RA Graves B. J., Johnson P. F., McKnight S. L.
RT Homologous recognition of a promoter domain common to the MSV LTR and the HSV tk gene
RL Cell 44:565-576 (1986).
RN [3]; RE0000177.
RX PUBMED: 2171780.
RA Poli V., Mancini F. P., Cortese R.
RT IL-6DBP, a nuclear protein involved in interleukin-6 signal transduction, defines a new family of leucine zipper proteins related to C/EBP
RL Cell 63:643-653 (1990).
RN [4]; RE0000504.
RX PUBMED: 1935900.
RA Samuelsson L., Stroemberg K., Vikman K., Bjursell G., Enerbaeck S.
RT The CCAAT/enhancer binding protein and its role in adipocyte differentiation: evidence for direct involvement in terminal adipocyte development
RL EMBO J. 10:3787-3793 (1991).
RN [5]; RE0000615.
RX PUBMED: 2824279.
RA Johnson P. F., Landschulz W. H., Graves B. J., McKnight S. L.
RT Identification of a rat liver nuclear protein that binds to the enhancer core element of three animal viruses
RL Genes Dev. 1:133-146 (1987).
RN [6]; RE0000630.
RX PUBMED: 2606350.
RA Christy R. J., Yang V. W., Ntambi J. M., Geiman D. E., Landschulz W. H., Friedman A. D., Nakabeppu Y., Kelly T. J., Lane M. D.
RT Differentiation-induced gene expression in 3T3-L1 preadipocytes: CCAAT/ enhancer binding protein interacts with and activates the promoters of two adipocyte-specific genes
RL Genes Dev. 3:1323-1335 (1989).
RN [7]; RE0000634.
RX PUBMED: 2558052.
RA Friedman A. D., Landschulz W. H., McKnight S. L.
RT CCAAT/enhancer binding protein activates the promoter of the serum albumin gene in cultured hepatoma cells
RL Genes Dev. 3:1314-1322 (1989).
RN [8]; RE0000669.
RX PUBMED: 2697636.
RA McKnight S. L., Lane M. D., Gluecksohn-Waelsch S.
RT Is CCAAT/enhancer-binding protein a central regulator of energy metabolism
RL Genes Dev. 3:2021-2024 (1989).
RN [9]; RE0000740.
RX PUBMED: 2227417.
RA Friedman A. D., McKnight S. L.
RT Identification of two polypeptide segments of CCAAT/enhancer-binding protein required for transcriptional activation of the serum albumin gene
RL Genes Dev. 4:1416-1426 (1990).
RN [10]; RE0000741.
RX PUBMED: 2792758.
RA Birkenmeier E. H., Gwynn B., Howard S., Jerry J., Gordon J. I., Landschulz W. H., McKnight S. L.
RT Tissue-specific expression, developmental regulation, and genetic mapping of the gene encoding CCAAT/enhancer binding protein
RL Genes Dev. 3:1146-1156 (1989).
RN [11]; RE0000742.
RX PUBMED: 1884998.
RA Williams S. C., Cantwell C. A., Johnson P. F.
RT A family of C/EBP-related proteins capable of forming covalently linked leucine zipper dimers in vitro
RL Genes Dev. 5:1553-1567 (1991).
RN [12]; RE0000787.
RX PUBMED: 8504929.
RA Vinson C. R., Hai T., Boyd S. M.
RT Dimerization specificity of the leucine zipper-containing bZIP motif on DNA binding: prediction and rational design
RL Genes Dev. 7:1047-1058 (1993).
RN [13]; RE0000797.
RX PUBMED: 8314088.
RA Nerlov C., Ziff E. B.
RT Three levels of functional interaction determine the activity of CCAAT/enhancer binding protein-alpha on the serum albumin promoter
RL Genes Dev. 8:350-362 (1994).
RN [14]; RE0000923.
RX PUBMED: 1689301.
RA Zhang D.-E., Hoyt P. R., Papaconstantinou J.
RT Localization of DNA Protein-binding Sites in the Proximal and Distal Promoter Regions of the Mouse alpha-Fetoprotein Gene
RL J. Biol. Chem. 265:3382-3391 (1990).
RN [15]; RE0001003.
RX PUBMED: 2050667.
RA Stewart M. J., Shean M. L., Paeper B. W., Duester G.
RT The role of CCAAT/enhancer-binding protein in the differential regulation of a family of human liver alcohol dehydrogenase genes
RL J. Biol. Chem. 266:11594-11603 (1991).
RN [16]; RE0001157.
RX PUBMED: 2157040.
RA Pei D., Shih C.
RT Transcriptional activation and repression by cellular DNA-binding protein C/EBP
RL J. Virol. 64:1517-1522 (1990).
RN [17]; RE0001218.
RX PUBMED: 2725492.
RA Ryden T. A., Beemon K.
RT Avian Retroviral Long Terminal Repeats Bind CCAAT/Enhancer-Binding Protein
RL Mol. Cell. Biol. 9:1155-1164 (1989).
RN [18]; RE0001369.
RX PUBMED: 2325658.
RA Trus M., Benvenisty N., Cohen H., Reshef L.
RT Developmentally Regulated Interaction of Liver Nuclear Factors with the Rat Phosphoenolpyruvate Carboxykinase Promoter
RL Mol. Cell. Biol. 10:2418-2422 (1990).
RN [19]; RE0001427.
RX PUBMED: 2476660.
RA Howell B. W., Lagace M., Shore M. C.
RT Activity of the Carbamyl Phosphate Synthetase I Promoter in Liver Nuclear Extracts is Dependent on a cis-Acting C/EBP Recognition Element
RL Mol. Cell. Biol. 9:2928-2933 (1989).
RN [20]; RE0001634.
RX PUBMED: 1996105.
RA Pei D., Shih C.
RT An attenuator domain is sandwiched by two distinct transactivation domains in the transcription factor C/EBP
RL Mol. Cell. Biol. 11:1480-1487 (1991).
RN [21]; RE0001745.
RX PUBMED: 8413284.
RA Johnson P. F.
RT Identification of C/EBP basic region residues involved in DNA sequence recognition and half-site spacing preference
RL Mol. Cell. Biol. 13:6919-6930 (1993).
RN [22]; RE0002192.
RX PUBMED: 2030941.
RA Bakker O., Parker M. G.
RT CAAT/enhancer binding protein is able to bind to ATF/CRE elements
RL Nucleic Acids Res. 19:1213-1217 (1991).
RN [23]; RE0002265.
RX PUBMED: 2922398.
RA Herbst R. S., Friedman N., Darnell J. E., Babiss L. E.
RT Positive and negative regulatory elements in the mouse albumin enhancer
RL Proc. Natl. Acad. Sci. USA 86:1553-1557 (1989).
RN [24]; RE0002479.
RX PUBMED: 1902571.
RA Trujillo M. A., Letovsky J., Maguire H. F., Lopez-Cabrera M., Siddiqui A.
RT Functional analysis of a liver-specific enhancer of the hepatitis B virus
RL Proc. Natl. Acad. Sci. USA 88:3797-3801 (1991).
RN [25]; RE0002592.
RX PUBMED: 2683088.
RA Vinson C. R., Sigler P. B., McKnight S. L.
RT Scissors-grip model for DNA recognition by a family of leucine zipper proteins
RL Science 246:911-916 (1989).
RN [26]; RE0002600.
RX PUBMED: 2494700.
RA Landschulz W. H., Johnson P. F., McKnight S. L.
RT The DNA binding domain of the rat liver nuclear protein C/EBP is bipartite
RL Science 243:1681-1688 (1989).
RN [27]; RE0002649.
RX PUBMED: 1987644.
RA Umek R. M., Friedman A. D., McKnight S. L.
RT CCAAT-enhancer binding protein: a component of a differentiation switch
RL Science 251:288-292 (1991).
RN [28]; RE0002680.
RX PUBMED: 2202050.
RA Shuman J. D., Vinson C. R., McKnight S. L.
RT Evidence of changes in protease sensitivity and subunit exchange rate on DNA binding by C/EBP
RL Science 249:771-774 (1990).
RN [29]; RE0002710.
RX PUBMED: 8211160.
RA Wagner S., Green M. R.
RT HTLV-I Tax protein stimulation of DNA binding of bZIP proteins by enhancing dimerization
RL Science 262:395-399 (1993).
RN [30]; RE0002726.
RX PUBMED: 1853580.
RA Lopez-Cabrera M., Letovsky J., Hu K.-Q., Siddiqui A.
RT Transcriptional factor C/EBP binds to and transactivates the enhancer element II of the hepatitis B virus
RL Virology 183:825-829 (1991).
RN [31]; RE0002760.
RX PUBMED: 2355919.
RA Dikstein R., Faktor O., Ben-Levy R., Shaul Y.
RT Functional Organization of the Hepatitis B Virus Enhancer
RL Mol. Cell. Biol. 10:3683-3689 (1990).
RN [32]; RE0002777.
RX PUBMED: 1566086.
RA Freytag S. O., Geddes T. J.
RT Reciprocal regulation of adipogenesis by Myc and C/EBPalpha
RL Science 256:379-382 (1992).
RN [33]; RE0003019.
RX PUBMED: 2850264.
RA Landschulz W. H., Johnson P. F., Adashi E. Y., Graves B. J., McKnight S. L.
RT Isolation of a recombinant copy of the gene encoding C/EBP
RL Genes Dev. 2:786-800 (1988).
RN [34]; RE0003022.
RX PUBMED: 1527059.
RA Mahoney C. W., Shuman J., McKnight S. L., Chen H. C., Huang K. P.
RT Phosphorylation of CCAAT-enhancer binding protein by protein kinase C attenuates site-selective DNA binding
RL J. Biol. Chem. 267:19396-19403 (1992).
RN [35]; RE0003024.
RX PUBMED: 1588957.
RA Mischoulon D., Rana B., Bucher N. L. R., Farmer S. R.
RT Growth-dependent inhibition of CCAAT/enhancer-binding protein (C/EBPalpha) gene expression during hepatocyte proliferation in the regenerating liver and in culture
RL Mol. Cell. Biol. 12:2553-2560 (1992).
RN [36]; RE0003025.
RX PUBMED: 8493090.
RA Legraverend C., Antonson P., Flodby P., Xanthopoulos K. G.
RT High level activity of the mouse CCAAT/enhancer binding protein (C/EBPalpha) gene promoter involves autoregulation and several ubiquitous transcription factors
RL Nucleic Acids Res. 21:1735- 1742 (1993).
RN [37]; RE0003027.
RX PUBMED: 7958846.
RA Freytag S. O., Paielli D. L., Gilbert J. D.
RT Ectopic expression of the CCAAT/enhancer-binding protein alpha promotes the adipogenic program in a variety of mouse fibroblastic cells
RL Genes Dev. 8:1654-1663 (1994).
RN [38]; RE0003173.
RX PUBMED: 8415748.
RA Lin F.-T., MacDougald O.A., Diehl A.M., Lane M.D.
RT A 30-kDa alternative translation product of the CCAAT/enhancer binding protein alpha message: Transcriptional activator lacking antimitotic activity
RL Proc. Natl. Acad. Sci. USA 90:9606-9610 (1993).
RN [39]; RE0003188.
RX PUBMED: 2389143.
RA ONeil K.T., Hoess R.H., DeGrado W.F.
RT Design of DNA-binding Peptides Based on the Leucine Zipper Motif
RL Science 249:774-778 (1990).
RN [40]; RE0004524.
RX PUBMED: 8321203.
RA Stein B., Cogswell P. C., Baldwin jr A. S.
RT Functional and physical associations between NF-kappaB and C/EBP family members: a Rel domain-bZIP interaction
RL Mol. Cell. Biol. 13:3964-3974 (1993).
RN [41]; RE0005297.
RX PUBMED: 8367486.
RA Ossipow V., Descombes P., Schibler U.
RT CCAAT/enhancer-binding protein mRNA is translated into multiple proteins with different transcription activation potentials
RL Proc. Natl. Acad. Sci. USA 90:8219-8223 (1993).
RN [42]; RE0006251.
RX PUBMED: 7556073.
RA Nerlov C., Ziff E. B.
RT CCAAT/enhancer binding protein-alpha amino acid motifs with dual TBP and TFIIB binding ability co-operate to activate transcription in both yeast and mammalian cells
RL EMBO J. 14:4318-4328 (1995).
RN [43]; RE0006669.
RX PUBMED: 7489722.
RA Krylov D., Olive M., Vinson C.
RT Extending dimerization interfaces: the bZIP basic region can form a coiled coil
RL EMBO J. 14:5329-5337 (1995).
RN [44]; RE0007060.
RX PUBMED: 8206947.
RA Jotte R. M., Kamata N., Holt J. T.
RT Myristylation-dependent transactivation by FBR v-fos is regulated by C/EBP
RL J. Biol. Chem. 269:16383-16396 (1994).
RN [45]; RE0009831.
RX PUBMED: 8065319.
RA Rana B., Mischoulon D., Xie Y., Bucher N. L. R., Farmer S. R.
RT Cell-extracellular matrix interactions can regulate the switch between growth and differentiation in rat hepatocytes: reciprocal expression of C/EBPalpha and immediate-early growth response transcription factors
RL Mol. Cell. Biol. 14:5858-5869 (1994).
RN [46]; RE0014413.
RX PUBMED: 1527171.
RA Cohn S. M., Simon T. C., Roth K. A., Birkenmeier E. H., Gordon J. I.
RT Use of transgenic mice to map cis-acting elements in the intestinal fatty acid binding protein gene (Fabpi) that control its cell lineage-specific and regional patterns of expression along the duodenal-colonic and crypt-villus axes of the gut epithelium
RL J. Cell Biol. 119:27-44 (1992).
RN [47]; RE0020256.
RX PUBMED: 7926792.
RA LINCOLN A.J., WILLIAMS S.C., JOHNSON P.F.
RT A revised sequence of the rat c/ebp gene.
RL Genes Dev. 8:1131-1132 (1994).
RN [48]; RE0048308.
RX PUBMED: 16582099.
RA Wissmuller S., Kosian T., Wolf M., Finzsch M., Wegner M.
RT The high-mobility-group domain of Sox proteins interacts with DNA-binding domains of many transcription factors.
RL Nucleic Acids Res. 34:1735-1744 (2006).
RN [49]; RE0050079.
RX PUBMED: 17254333.
RA Calella A. M., Nerlov C., Lopez R. G., Sciarretta C., von Bohlen Und Halbach O., Bereshchenko O., Minichiello L.
RT Neurotrophin/Trk receptor signaling mediates C/EBPalpha, -beta and NeuroD recruitment to immediate-early gene promoters in neuronal cells and requires C/EBPs to induce immediate-early gene transcription.
RL Neural Develop. 2:4 (2007).
RN [50]; RE0053527.
RX PUBMED: 17094771.
RA Park M. J., Kong H. J., Kim H. Y., Kim H. H., Kim J. H., Cheong J. H.
RT Transcriptional repression of the gluconeogenic gene PEPCK by the orphan nuclear receptor SHP through inhibitory interaction with C/EBPalpha.
RL Biochem. J. 402:567-574 (2007).
XX
//