
AC T09097
XX
ID T09097
XX
DT 20.06.2006 (created); jag.
DT 05.11.2012 (updated); sup.
CO Copyright (C), QIAGEN.
XX
FA SRY
XX
SY sex-determining region Y gene product; TDF; testis-determining factor.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G000388 SRY; HGNC: SRY.
XX
CL C0015; HMG.
XX
SZ 204 AA; 23.9 kDa (cDNA) (calc.).
XX
SQ MQSYASAMLSVFNSDDYSPAVQENIPALRRSSSFLCTESCNSKYQCETGENSKGNVQDRV
SQ KRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMH
SQ REKYPNYKYRPRRKAKMLPKNCSLLPADPASVLCSEVQLDNRLYRDDCTKATHSRMEHQL
SQ GHLPPINAASSPQQRDRYSHWTKL
XX
SC Swiss-Prot#Q05066
XX
FT 57 137
HMG domain [7].
FT 59 129
SM00398; hmgende2.
FT 60 128
PF00505; HMG (high mobility group) box.
FT 60 128
PS50118; HMG_BOX_2.
FT 65 81
alpha-helix 1 [5].
FT 88 100
alpha-helix 2 [5].
FT 102 123
alpha-helix 3 [5].
XX
IN T09357 BRN1; mouse, Mus musculus.
IN T08466 c-Jun; rat, Rattus norvegicus.
IN T00108 C/EBPalpha-isoform1; rat, Rattus norvegicus.
IN T03989 Dlx-5; mouse, Mus musculus.
IN T18895 Egr-2-isoform1; rat, Rattus norvegicus.
IN T09354 Hex; mouse, Mus musculus.
IN T01790 HTF4alpha; rat, Rattus norvegicus.
IN T09290 OLIG2; mouse, Mus musculus.
IN T16574 Pax-3; rat, Rattus norvegicus.
IN T08484 Sp1-isoform1; human, Homo sapiens.
IN T08886 UTF1-isoform1; mouse, Mus musculus.
XX
MX M08899 V$SOX_Q4.
MX M01014 V$SOX_Q6.
MX M00148 V$SRY_01.
MX M00160 V$SRY_02.
MX M03854 V$SRY_Q6.
XX
BS R03579.
BS R03580.
BS R03581.
BS R07475.
BS R07476.
BS R07477.
BS R07478.
BS R07479.
BS R07480.
BS R07481.
BS R07482.
BS R07483.
BS R07484.
BS R07485.
BS R07486.
BS R07487.
BS R07488.
BS R07489.
BS R07490.
BS R07491.
BS R07492.
BS R07493.
BS R07494.
BS R07495.
BS R07496.
BS R07497.
BS R07498.
BS R07499.
BS R07500.
BS R07501.
BS R07502.
BS R07503.
BS R15193.
BS R15194.
BS R15195.
BS R15196.
BS R15197.
BS R15198.
BS R15199.
BS R15200.
BS R03576.
BS R04297.
BS R33690.
BS R33689.
BS R34750.
BS R03577.
XX
DR TRANSPATH: MO000083300.
DR EMBL: L08063;
DR EMBL: L10101;
DR EMBL: L10102;
DR EMBL: S53156;
DR EMBL: S56543;
DR EMBL: X53772;
DR UniProtKB: Q05066;
XX
RN [1]; RE0000305.
RX PUBMED: 1425584.
RA Ferrari S., Harley V. R., Pontiggia A., Goodfellow P. N., Lovell-Badge R., Bianchi M. E.
RT SRY, like HMG1, recognizes sharp angles in DNA
RL EMBO J. 11:4497-4506 (1992).
RN [2]; RE0002703.
RX PUBMED: 1734522.
RA Harley V. R., Jackson D. I., Hextall P. J., Hawkins J. R., Berkovitz G. D., Sockanathan S., Lovell-Badge R., Goodfellow P. N.
RT DNA binding activity of recombinant SRY from normal males and XY females
RL Science 255:453-456 (1992).
RN [3]; RE0003119.
RX PUBMED: 7813448.
RA Pontiggia A., Rimini R., Harley V. R., Goodfellow P. N., Lovell-Badge R., Bianchi M. E.
RT Sex-reversing mutations affect the architecture of SRY--DNA complexes
RL EMBO J. 13:6115-6124 (1994).
RN [4]; RE0005078.
RX PUBMED: 8159753.
RA Giese K., Pagel J., Grosschedl R.
RT Distinct DNA-binding properties of the high mobility group domain of murine and human SRY sex-determining factors
RL Proc. Natl. Acad. Sci. USA 91:3368-3372 (1994).
RN [5]; RE0005081.
RX PUBMED: 7774012.
RA Werner M. H., Huth J. R., Gronenborn A. M., Clore G. M.
RT Molecular basis of human 46X,Y sex reversal revealed from the three-dimensional solution structure of the human SRY-DNA complex
RL Cell 81:705-714 (1995).
RN [6]; RE0048308.
RX PUBMED: 16582099.
RA Wissmuller S., Kosian T., Wolf M., Finzsch M., Wegner M.
RT The high-mobility-group domain of Sox proteins interacts with DNA-binding domains of many transcription factors.
RL Nucleic Acids Res. 34:1735-1744 (2006).
RN [7]; RE0075064.
RX PUBMED: 19902333.
RA Sato Y., Shinka T., Sakamoto K., Ewis A. A., Nakahori Y.
RT The male-determining gene SRY is a hybrid of DGCR8 and SOX3, and is regulated by the transcription factor CP2.
RL Mol. Cell. Biochem. 337:267-275 (2010).
XX
//