TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T08886 XX ID T08886 XX DT 03.05.2006 (created); sla. DT 30.10.2006 (updated); jay. CO Copyright (C), QIAGEN. XX FA UTF1-isoform1 XX SY undifferentiated embryonic cell transcription factor 1; UTF1. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G009638 Utf1. XX CL C0009; ZIP. XX SZ 339 AA; 36.4 kDa (cDNA) (calc.). XX SQ MLLRPRRLPAFSPPSPASPDAELRSAGDVPVTTSDAFATSGGMAEPGSPKAPVSPDSAQR SQ TPWSARETELLLGTLLQPAMWRSLLLDRRQTLPTYRRVSAALARQQVRRTPAQCRRRYKF SQ LKDKLRDSQGQPSGPFDNQIRQLMGLLGDDGPPRVRRRSTGPGRPQRRGRSSLSALAPAP SQ APVEQEAELPLAAENDEPAPALRFSSSTTKSAGAHRITSSPPLTSTDTLPPEPGHTFESS SQ PTPTPDHDVETPNEPPGLSQGRASSPQVAPQSLNTALLQTLTHLGDISTVLGPLRDQLST SQ LNQHVEHLRGSFDQTVSLAVGFILGSAASERGILGDLRQ XX SC translated from EMBL:D31647 XX CP undifferentiated EC cells (F9 and P19), embryonic stem cells (ES), low level in ovary and testis of 8 week old mice, inner cell mass of blastocyst (3.5 dpc), primitive ectoderm at 6.5-7.5 dpc, low level in the neural fold at 8 dpc, strong level in the chorion at 8 dpc and furthermore detected until 13.5 dpc [2]. CN liver, kidney, spleen, lung, and brain of 8 week old mice, morula at 3dpc, trophectoderm at 3.5 dpc, mesoderm at 6.5-7.5 dpc, [2]. XX FF boost adenovirus E2A promoter activity via direct interaction with the activation domain of the promoter-bound ATF-2 protein [2]; XX IN T08441 Sox-10; rat, Rattus norvegicus. IN T14088 Sox-8; mouse, Mus musculus. IN T09097 SRY; human, Homo sapiens. XX DR TRANSPATH: MO000080911. DR EMBL: D31647; D31647. DR UniProtKB: Q6J1H4; O70530. XX RN [1]; RE0048308. RX PUBMED: 16582099. RA Wissmuller S., Kosian T., Wolf M., Finzsch M., Wegner M. RT The high-mobility-group domain of Sox proteins interacts with DNA-binding domains of many transcription factors. RL Nucleic Acids Res. 34:1735-1744 (2006). RN [2]; RE0047690. RX PUBMED: 9524124. RA Okuda A., Fukushima A., Nishimoto M., Orimo A., Yamagishi T., Nabeshima Y., Kuro-o M., Nabeshima Y., Boon K., Keaveney M., Stunnenberg H. G., Muramatsu M. RT UTF1, a novel transcriptional coactivator expressed in pluripotent embryonic stem cells and extra-embryonic cells. RL EMBO J. 17:2019-2032 (1998). XX //