TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T01790 XX ID T01790 XX DT 03.05.1996 (created); ewi. DT 26.10.2006 (updated); ili. CO Copyright (C), QIAGEN. XX FA HTF4alpha XX SY ALF1B; REBbeta; salivary-specific CRE-binding protein alpha; SCBPA; TCF12; transcription factor 12. XX OS rat, Rattus norvegicus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G014506 Tcf12. XX CL C0010; bHLH. XX SZ 707 AA; 75.9 kDa (cDNA) (calc.). XX SQ MNPQQQRMAAIGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGMDERGGTTSW SQ GTSGQPSPSYDSSRGFTDSPHYSDHLNDSRLGTHEGLSPTPFMNSNLIGKTSERGSFSLY SQ SRDSGLSGCQSSLLRQDLGLGSPAQLSSSGKPGTPYYSFSATSSRRRPLHDSVALDPLQA SQ KKVRKVPPGLPSSVYAPSPNSDDFNRESPSYPSPKPPTSMFASTFFMQDGTHSSSDLWSS SQ SNGMSQPGFGGILGTSTSHMSQSSSYGSLHSHDRLSYPPHSVSPTDINTSLPPMSSFHRG SQ STSSSPYVAASHTPPINGSDSILGTRGNAAGSSQTGDALGKALASIYSPDHTSSSFPSNP SQ STPVGSPSPLTAGTSQWPRAGGQAPSSPSYENSLHSLKNRVEQQLHEHLQDAMSFLKDVC SQ EQSRMEDRLDRLDDAIHVLRNHAVGPSTSLPTSHSDIHSLLGPSHNAPIGNLNSNYGGSS SQ LVTNSRSASMVGTHREDSVSLNGNHSVLSSTVAASNTELNHKTPESFRGGVQNQSGSVVP SQ TEIKTENKEKDENLHEPPSSDDMKSDDESSQKDIKVSSRGRTSSTNEDEDLNPEQKIERE SQ KERRMANNARERLRVRDINEAFKELGRMCQLHLKSEKPQTKLLILHQAVAVILSLEQQVR SQ ERNLNPKAACLKRREEEKVSAASAEPPTTLPGTHPGLSETTNPMGHL XX SC conceptually translated from EMBL/GenBank/DDBJ #L09656 and #S53920 XX FT 72 639 PF00478; IMP dehydrogenase / GMP reductase domain. FT 405 435 helical inhibitory domain (HID) [1]. FT 601 656 PS50888; HLH. FT 603 656 PF00010; Helix-loop-helix DNA-binding domain. FT 608 661 SM00353; finulus. XX SF two splice variants are SCBPgamma and SCBPbeta [2]; SF the insert of the alpha variant has been reported to be similar to ankyrin-repeats, probably to fold as an amphiphilic alpha-helix, and to exert inhibiting function on factor dimerization [1]; SF it thus binds to DNA in a much less effective way than SCBPgamma [1]; XX CP ubiquitous [1]. XX FF weaker activator than SCBPgamma, responding to enhanced cAMP levels [2]; FF HTF4alpha (REBbeta) is predominant over SCBPgamma (REBalpha) in the pituitary gland and brain [1]; FF gradual decrease from embryonic day 14 to neonatal day 10 [1]; XX IN T01789 HTF4gamma; rat, Rattus norvegicus. IN T00484 MASH-1; rat, Rattus norvegicus. IN T00485 MASH-2; rat, Rattus norvegicus. IN T00512 MRF4; rat, Rattus norvegicus. IN T00526 MyoD; mouse, Mus musculus. IN T08441 Sox-10; rat, Rattus norvegicus. IN T14088 Sox-8; mouse, Mus musculus. IN T09097 SRY; human, Homo sapiens. XX MX M00973 V$E2A_Q6. MX M01034 V$EBOX_Q6_01. MX M00698 V$HEB_Q6. MX M02018 V$HTF4_Q2. XX DR TRANSPATH: MO000025927. DR EMBL: L09656; DR EMBL: S53920; DR UniProtKB: P51514-1; HTF4_RAT. XX RN [1]; RE0003628. RX PUBMED: 8422988. RA Klein E. S., Simmons D. M., Swanson L. W., Rosenfeld M. G. RT Tissue-specific RNA splicing generates an ankyrin-like domain that affects the dimerization and DNA-binding properties of a bHLH protein RL Genes Dev. 7:55-71 (1993). RN [2]; RE0003729. RX PUBMED: 7683670. RA Lin H. H., Li W. Y., Ann D. K. RT The helix-loop-helix proteins (salivary-specific cAMP response element-binding proteins) can modulate cAMP-inducible RP4 gene expression in salivary cells RL J. Biol. Chem. 268:10214-10220 (1993). RN [3]; RE0003746. RX PUBMED: 1335317. RA Lin H. H., Ann D. K. RT Identification of cis- and trans-acting factors regulating the expression of rat salivary-specific RP4 gene RL Gene Expr. 2:365-377 (1992). RN [4]; RE0048308. RX PUBMED: 16582099. RA Wissmuller S., Kosian T., Wolf M., Finzsch M., Wegner M. RT The high-mobility-group domain of Sox proteins interacts with DNA-binding domains of many transcription factors. RL Nucleic Acids Res. 34:1735-1744 (2006). XX //