![TRANSFAC-Logo](/transfac_factor/images/logo_genexplain.png)
AC T08484
XX
ID T08484
XX
DT 25.01.2006 (created); pra.
DT 26.08.2014 (updated); hna.
CO Copyright (C), QIAGEN.
XX
FA Sp1-isoform1
XX
SY simian-virus-40-protein-1; Sp1; specificity protein 1; Stimulating Protein 1; stimulatory protein 1.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G004580 SP1; HGNC: Sp1.
XX
CL C0001; CH.
XX
SZ 785 AA; 80.7 kDa (cDNA) (calc.), 105+95 kDa (SDS)
XX
SQ MSDQDHSMDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGSSSSTGGGGQESQPSP
SQ LALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPTS
SQ KEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQ
SQ TVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQG
SQ LANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAVTISSSGSQESGSQPVT
SQ SGTTISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTTSGSSGTNSQGQTPQRVS
SQ GLQGSDALNIQQNQTSGGSLQAGQQKEGEQNQQTQQQQILIQPQLVQGGQALQALQAAPL
SQ SGQTFTTQAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQ
SQ TITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTS
SQ GIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTR
SQ REACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTW
SQ SYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALS
SQ VGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVADLQSINI
SQ SGNGF
XX
SC translated from EMBL #BC062539
XX
FT 146 251
Q-rich region (23/106), domain A, necessary for synergistic activation [11].
FT 146 251
Q-rich region (23/106), domain A, necessary for synergistic activation [10].
FT 229 680
PF00478; IMP dehydrogenase / GMP reductase domain.
FT 352 494
Q-rich region (39/143), important for multimerization [11].
FT 393 574
interactions with Oct-1 [8].
FT 513 631
Gln-rich part of domain B [7].
FT 549 785
interactions with myogenin [13].
FT 560 626
charged region, domain C [11].
FT 560 626
essential for cooperative DNA binding with SREBP-1 [10].
FT 626 650
PF00096; zf-C2H2.
FT 626 650
SM00355; c2h2final6.
FT 626 655
PS50157; ZINC_FINGER_C2H2_2.
FT 628 708
ZNF domain [14].
FT 628 785
interaction with YY1 [9].
FT 656 680
PF00096; zf-C2H2.
FT 656 680
SM00355; c2h2final6.
FT 656 685
PS50157; ZINC_FINGER_C2H2_2.
FT 686 708
PF00096; zf-C2H2.
FT 686 708
SM00355; c2h2final6.
FT 686 713
PS50157; ZINC_FINGER_C2H2_2.
FT 709 785
domain D, required for synergism [10].
FT 709 785
domain D, required for synergism [12].
XX
FF plays an important role in tumor angiogenesis and contributes to the aggressive biology of human pancreatic adenocarcinoma [15];
FF Chromatin, TAFs and a new coactivator, which includes CBP, are all required to mediate full synergistic activation by Dp1 and SREBP-1a [16];
FF In response to heregulin ERK phosphorylates Sp1-isoform1 on serine [2];
FF Sp1-isoform1 and SREBP-1a added together leads to a synergistic activation of LDLR promoter [16];
XX
IN T06595 C/EBPbeta-FL; human, Homo sapiens.
IN T09117 E2F-1; human, Homo sapiens.
IN T08300 ER-alpha-L; human, Homo sapiens.
IN T09383 GABP-alpha; human, Homo sapiens.
IN T05299 NR1B1; human, Homo sapiens.
IN T08441 Sox-10; rat, Rattus norvegicus.
IN T14088 Sox-8; mouse, Mus musculus.
IN T09097 SRY; human, Homo sapiens.
IN T14458 STAT3; Mammalia.
XX
MX M00008 V$SP1_01.
MX M02281 V$SP1_03.
MX M00933 V$SP1_Q2_01.
MX M07395 V$SP1_Q2_02.
MX M07063 V$SP1_Q3.
MX M00932 V$SP1_Q4_01.
MX M00196 V$SP1_Q6.
MX M00931 V$SP1_Q6_01.
XX
BS R01765.
BS R01764.
BS R00315.
BS R04818.
BS R10094.
BS R02101.
BS R04465.
BS R04676.
BS R04813.
BS R04814.
BS R04815.
BS R04816.
BS R04817.
BS R04877.
BS R05157.
BS R05158.
BS R05159.
BS R05160.
BS R05161.
BS R05162.
BS R05163.
BS R05164.
BS R05165.
BS R05166.
BS R05167.
BS R18719.
BS R19123.
BS R22279.
BS R25822.
BS R19122.
BS R04979.
BS R37389.
BS R00191.
BS R03282.
BS R02010.
BS R02013.
BS R00704.
BS R35212.
BS R35214.
BS R42189.
BS R42190.
BS R42193.
BS R42199.
BS R42200.
BS R42201.
BS R42202.
BS R42204.
BS R04873.
BS R13584.
BS R29553.
BS R41712.
BS R41713.
BS R41714.
BS R41715.
BS R31691.
BS R31692.
BS R31694.
BS R31695.
BS R31696.
BS R31698.
BS R31700.
BS R01754.
BS R01756.
BS R01758.
BS R01753.
BS R01755.
BS R01761.
BS R01762.
BS R01763.
BS R04829.
BS R04830.
BS R04831.
BS R60651.
BS R20839.
BS R19583.
BS R39347.
BS R39351.
BS R39353.
BS R20867.
BS R24619.
BS R24624.
BS R04426.
BS R03051.
BS R03052.
BS R03053.
BS R02423.
BS R02424.
BS R02426.
BS R02428.
BS R02432.
BS R02433.
BS R02435.
BS R02436.
BS R02438.
BS R02439.
BS R02440.
BS R34742.
BS R34743.
BS R25012.
BS R11778.
BS R21075.
BS R12758.
BS R35030.
BS R04376.
BS R10055.
BS R25544.
BS R25545.
BS R25546.
BS R35060.
BS R35061.
BS R04421.
BS R04422.
BS R40974.
BS R31521.
BS R29833.
BS R32597.
BS R56524.
BS R56533.
BS R56534.
BS R56536.
BS R56540.
BS R56544.
BS R56545.
BS R36315.
BS R13261.
BS R38424.
BS R38425.
BS R38426.
BS R38427.
BS R22932.
BS R04679.
BS R04680.
BS R32297.
BS R32298.
BS R32299.
BS R32300.
BS R35022.
BS R16910.
BS R15185.
BS R15186.
BS R29627.
BS R00385.
BS R17084.
BS R13586.
BS R60857.
BS R60859.
BS R26908.
BS R16054.
BS R12093.
BS R25434.
BS R13258.
BS R04493.
BS R31040.
BS R00560.
BS R04934.
BS R04935.
BS R04936.
BS R03118.
BS R23368.
BS R04834.
BS R31439.
BS R31444.
BS R00769.
BS R01770.
BS R31855.
BS R21580.
BS R21582.
BS R21584.
BS R21583.
BS R29721.
BS R04951.
BS R24136.
BS R13413.
BS R23752.
BS R04716.
BS R21257.
BS R21259.
BS R35350.
BS R42150.
BS R38273.
BS R14787.
BS R17170.
BS R17172.
BS R20744.
BS R28292.
BS R22800.
BS R22801.
BS R22802.
BS R22803.
BS R23757.
BS R33184.
BS R25821.
BS R16659.
BS R16660.
BS R16661.
BS R16671.
BS R16672.
BS R16673.
BS R16674.
BS R16675.
BS R16676.
BS R16677.
BS R16678.
BS R33688.
BS R04734.
BS R33214.
BS R04995.
BS R04996.
BS R04997.
BS R04998.
BS R05000.
BS R05001.
BS R05003.
BS R63597.
BS R22278.
BS R04621.
BS R08503.
BS R22775.
BS R04700.
BS R04701.
BS R24220.
BS R24213.
BS R04840.
BS R34358.
BS R59604.
BS R22776.
BS R18828.
BS R24977.
BS R14157.
BS R14205.
BS R14208.
BS R13318.
BS R17010.
BS R17011.
BS R17012.
BS R17013.
BS R17014.
BS R17015.
BS R56709.
BS R56713.
BS R56715.
BS R56718.
BS R04625.
BS R04626.
BS R09714.
BS R32652.
BS R32653.
BS R32654.
BS R33727.
BS R33728.
BS R33729.
BS R33730.
BS R33731.
BS R17208.
BS R36677.
BS R36679.
BS R36682.
BS R36683.
BS R56974.
BS R56975.
BS R30995.
BS R30997.
BS R27272.
BS R42191.
BS R16236.
BS R16933.
BS R04918.
BS R24770.
BS R24771.
BS R24772.
BS R12741.
BS R39654.
BS R19135.
BS R21040.
BS R21044.
BS R55790.
BS R14777.
BS R14778.
BS R09485.
BS R09487.
BS R09488.
BS R09489.
BS R09490.
BS R18822.
BS R18823.
BS R18824.
BS R18825.
BS R18826.
BS R14285.
BS R41798.
BS R41799.
BS R41800.
BS R01728.
BS R04755.
BS R17070.
BS R17101.
BS R17102.
BS R17103.
BS R36174.
BS R55981.
BS R55982.
BS R21429.
BS R27613.
BS R27615.
BS R27616.
BS R35951.
BS R35954.
BS R61067.
BS R61068.
BS R14423.
BS R02857.
BS R02858.
BS R02859.
BS R02860.
BS R15637.
BS R15638.
BS R35041.
BS R32202.
BS R57910.
BS R21546.
BS R21547.
BS R21605.
BS R21606.
BS R21607.
BS R19433.
BS R19434.
BS R19435.
BS R18751.
BS R01442.
BS R01444.
BS R02704.
BS R09898.
BS R04741.
BS R57423.
BS R57426.
BS R57434.
BS R03722.
BS R04007.
BS R04008.
BS R04009.
BS R37822.
BS R39121.
BS R34068.
BS R04005.
BS R08141.
BS R26284.
BS R02873.
BS R03336.
BS R28528.
BS R60900.
BS R29099.
BS R26443.
BS R23126.
BS R23127.
BS R30137.
BS R30139.
BS R30140.
BS R16940.
BS R31446.
BS R14520.
BS R30262.
BS R30102.
BS R37034.
BS R39646.
BS R39647.
BS R39648.
BS R21083.
BS R21086.
BS R31922.
BS R16584.
BS R01021.
BS R04854.
BS R19121.
BS R18735.
BS R18736.
BS R18737.
BS R29105.
BS R04691.
BS R33658.
BS R31910.
BS R36759.
BS R36760.
BS R02850.
BS R09536.
BS R31916.
BS R04757.
BS R03041.
BS R40177.
BS R03486.
BS R56243.
BS R41808.
BS R41810.
BS R41812.
BS R41814.
BS R41816.
BS R12709.
BS R16597.
BS R37127.
BS R12971.
BS R12973.
BS R12978.
BS R03367.
BS R03373.
BS R04671.
BS R22114.
BS R04669.
BS R14854.
BS R17125.
BS R04750.
BS R04282.
BS R14215.
BS R14216.
BS R34143.
BS R02660.
BS R08095.
BS R15644.
BS R04431.
BS R18847.
BS R18848.
BS R18849.
BS R18864.
BS R29157.
BS R21170.
BS R21171.
BS R04794.
BS R04795.
BS R39360.
BS R20584.
BS R38021.
BS R22238.
BS R22243.
BS R26183.
BS R24290.
BS R21091.
BS R04743.
BS R20635.
BS R39046.
BS R39047.
BS R39051.
BS R21328.
BS R21330.
BS R34787.
BS R34790.
BS R37961.
BS R01484.
BS R41083.
BS R41085.
BS R01375.
BS R01376.
BS R01381.
XX
DR TRANSPATH: MO000058770.
DR EMBL: BC062539; BC062539.
DR EMBL: J03133; HSTFSP1.
DR UniProtKB: P08047; SP1_HUMAN.
XX
RN [1]; RE0012787.
RX PUBMED: 8657141.
RA Karlseder J., Rotheneder H., Wintersberger E.
RT Interaction of Sp1 with the growth- and cell cycle regulated transcription factor E2F
RL Mol. Cell. Biol. 16:1659-1667 (1996).
RN [2]; RE0029414.
RX PUBMED: 11997063.
RA Gyrd-Hansen M., Krag T. O., Rosmarin A. G., Khurana T. S.
RT Sp1 and the ets-related transcription factor complex GABP alpha/beta functionally cooperate to activate the utrophin promoter.
RL J. Neurol. Sci. 197:27-35 (2002).
RN [3]; RE0048308.
RX PUBMED: 16582099.
RA Wissmuller S., Kosian T., Wolf M., Finzsch M., Wegner M.
RT The high-mobility-group domain of Sox proteins interacts with DNA-binding domains of many transcription factors.
RL Nucleic Acids Res. 34:1735-1744 (2006).
RN [4]; RE0063616.
RX PUBMED: 18793716.
RA Harris S. M., Harvey E. J., Hughes T. R., Ramji D. P.
RT The interferon-gamma-mediated inhibition of lipoprotein lipase gene transcription in macrophages involves casein kinase 2- and phosphoinositide-3-kinase-mediated regulation of transcription factors Sp1 and Sp3.
RL Cell. Signal. 20:2296-2301 (2008).
RN [5]; RE0064849.
RX PUBMED: 19885854.
RA Yiu W. H., Yeung T. L., Poon J. W., Tsui S. K., Fung K. P., Waye M. M.
RT Transcriptional regulation of IER3IP1 gene by tumor necrosis factor-alpha and Sp family proteins.
RL Cell Biochem. Funct. 28:31-37 (2009).
RN [6]; RE0066993.
RX PUBMED: 19843539.
RA Reichman S., Kalathur R. K., Lambard S., Ait-Ali N., Yang Y., Lardenois A., Ripp R., Poch O., Zack D. J., Sahel J. A., Leveillard T.
RT The homeobox gene CHX10/VSX2 regulates RdCVF promoter activity in the inner retina.
RL Hum. Mol. Genet. 19:250-261 (2010).
RN [7]; RE0024063.
RX PUBMED: 10506225.
RA Kardassis D., Papakosta P., Pardali K., Moustakas A.
RT c-Jun transactivates the promoter of the human p21(WAF1/Cip1) gene by acting as a superactivator of the ubiquitous transcription factor Sp1.
RL J. Biol. Chem. 274:29572-29581 (1999).
RN [8]; RE0005325.
RX PUBMED: 8441665.
RA Wasylyk C., Wasylyk B.
RT Oncogenenic conversion of Ets affects redox regulation in-vivo and in-vitro
RL Nucleic Acids Res. 21:523-529 (1993).
RN [9]; RE0006591.
RX PUBMED: 8327494.
RA Lee J.-S., Galvin K. M., Shi Y.
RT Evidence for physical interaction between the zinc-finger transcription factors YY1 and Sp1
RL Proc. Natl. Acad. Sci. USA 90:6145-6149 (1993).
RN [10]; RE0006739.
RX PUBMED: 7597088.
RA Yieh L., Sanchez H. B., Osborne T. F.
RT Domains of transcription factor Sp1 required for synergistic activation with sterol regulatory element binding protein 1 of low density lipoprotein receptor promoter
RL Proc. Natl. Acad. Sci. USA 92:6102-6106 (1995).
RN [11]; RE0000121.
RX PUBMED: 3142690.
RA Courey A. J., Tjian R.
RT Analysis of Sp1 in vivo reveals multiple transcriptional domains, including a novel glutamine-rich activation motif
RL Cell 55:887-898 (1988).
RN [12]; RE0000707.
RX PUBMED: 1885006.
RA Pascal E., Tjian R.
RT Different activation domains of Sp1 govern formation of multimers and mediate transcriptional synergism
RL Genes Dev. 5:1646-1656 (1991).
RN [13]; RE0025127.
RX PUBMED: 10082523.
RA Biesiada E., Hamamori Y., Kedes L., Sartorelli V.
RT Myogenic basic helix-loop-helix proteins and Sp1 interact as components of a multiprotein transcriptional complex required for activity of the human cardiac alpha-actin promoter.
RL Mol. Cell. Biol. 19:2577-2584 (1999).
RN [14]; RE0064660.
RX PUBMED: 18258854.
RA Tan N. Y., Midgley V. C., Kavurma M. M., Santiago F. S., Luo X., Peden R., Fahmy R. G., Berndt M. C., Molloy M. P., Khachigian L. M.
RT Angiotensin II-inducible platelet-derived growth factor-D transcription requires specific Ser/Thr residues in the second zinc finger region of Sp1.
RL Circ. Res. 102:e38-51 (2008).
RN [15]; RE0047855.
RX PUBMED: 11358838.
RA Shi Q., Le X., Abbruzzese J. L., Peng Z., Qian C. N., Tang H., Xiong Q., Wang B., Li X. C., Xie K.
RT Constitutive Sp1 activity is essential for differential constitutive expression of vascular endothelial growth factor in human pancreatic adenocarcinoma.
RL Cancer Res. 61:4143-4154 (2001).
RN [16]; RE0047975.
RX PUBMED: 9765204.
RA Naar A. M., Beaurang P. A., Robinson K. M., Oliner J. D., Avizonis D., Scheek S., Zwicker J., Kadonaga J. T., Tjian R.
RT Chromatin, TAFs, and a novel multiprotein coactivator are required for synergistic activation by Sp1 and SREBP-1a in vitro.
RL Genes Dev. 12:3020-3031 (1998).
XX
//