AC T06595
XX
ID T06595
XX
DT 20.05.2005 (created); oke.
DT 26.09.2014 (updated); spk.
CO Copyright (C), QIAGEN.
XX
FA C/EBPbeta-FL
XX
SY C/EBP-beta; C/EBP-beta1; C/EBPbeta-FL; CCAAT/enhancer binding protein (C/EBP), beta; CEBPB; CRP2; IL6DBP; MGC32080; NF-IL6; NF-IL6-1; PP9092; TCF5.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G002899 CEBPB; HGNC: CEBPB.
XX
CL C0008; bZIP.
XX
SZ 345 AA; 36.1 kDa (cDNA) (calc.), 43kDa [5]
XX
SQ MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPA
SQ GELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSD
SQ LFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFE
SQ PADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPAD
SQ AKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQ
SQ HKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC
XX
SC Swiss-Prot#P17676-1
XX
FT 235 235 
Thr-phosphorylation by MAP kinases [2].
FT 266 272 
complex stabilizing subdomain [1].
FT 266 345 
tryptic core domain within DNA complex [1].
FT 269 333 
SM00338; brlzneu.
FT 270 323 
PF07716; Basic region leucine zipper.
FT 271 334 
PS50217; BZIP.
XX
SF one of the three forms encoded by the human CEBPbeta gene that result from the usage of different in frame AUGs of the same mRNA species [5];
SF the longest form [5];
SF bZIP domain of C/EBPbeta-FL is involved in direct interactions with c-Jun [3];
XX
FF activator [5];
FF induced by retinoic acid in NT2/D1 cells [5];
XX
IN T09531 ATF-4; human, Homo sapiens.
IN T04877 ATF-5; human, Homo sapiens.
IN T18798 ATFa-isoform3; human, Homo sapiens.
IN T18808 B-ATF; human, Homo sapiens.
IN T05452 BAF155; human, Homo sapiens.
IN T05499 BAF47; human, Homo sapiens.
IN T18804 batf3; human, Homo sapiens.
IN T05451 BRG1; human, Homo sapiens.
IN T01261 Brm; human, Homo sapiens.
IN T00105 C/EBPalpha; human, Homo sapiens.
IN T06595 C/EBPbeta-FL; human, Homo sapiens.
IN T09139 C/EBPdelta; human, Homo sapiens.
IN T04883 C/EBPepsilon; human, Homo sapiens.
IN T09524 C/EBPgamma; human, Homo sapiens.
IN T09526 CHOP-10-isoform1; human, Homo sapiens.
IN T09550 CREBPA-Alpha; human, Homo sapiens.
IN T09554 DBP; human, Homo sapiens.
IN T00244 Egr-1; mouse, Mus musculus.
IN T08300 ER-alpha-L; human, Homo sapiens.
IN T09383 GABP-alpha; human, Homo sapiens.
IN T08321 p53-isoform1; human, Homo sapiens.
IN T00671 p53; human, Homo sapiens.
IN T08628 POU2F1; Mammalia.
IN T01661 PR A; human, Homo sapiens.
IN T00696 PR B; human, Homo sapiens.
IN T22463 SNF2H; human, Homo sapiens.
IN T22464 SNF2H; human, Homo sapiens.
IN T08484 Sp1-isoform1; human, Homo sapiens.
IN T02113 TAFII31; human, Homo sapiens.
XX
MX M00109 V$CEBPB_01.
MX M00117 V$CEBPB_02.
MX M07315 V$CEBPB_Q3.
MX M01896 V$CEBPB_Q6.
MX M00912 V$CEBP_Q2_01.
MX M00770 V$CEBP_Q3.
XX
BS R57760.
BS R57763.
BS R57764.
BS R57852.
BS R34771.
BS R08086.
BS R58218.
BS R58222.
BS R58225.
BS R58226.
BS R58231.
XX
DR TRANSPATH: MO000054454.
DR TRANSCOMPEL: C00115.
DR EMBL: BC007538;
DR EMBL: BC021931;
DR EMBL: X52560;
DR UniProtKB: P17676-1;
XX
RN [1]; RE0001110.
RX PUBMED: 8144615.
RA Brasier A. R., Kumar A.
RT Identification of a novel determinant for basic domain-leucine zipper DNA binding activity in the acute-phase inducible nuclear factor-interleukin-6 transcription factor
RL J. Biol. Chem. 269:10341-10351 (1994).
RN [2]; RE0003030.
RX PUBMED: 8384717.
RA Nakajima T., Kinoshita S., Sasagawa T., Sasaki K., Naruto M., Kishimoto T., Akira S.
RT Phosphorylation at threonine-235 by ras-dependent mitogen-activated protein kinase cascade is essential for transcription factor NF-IL6
RL Proc. Natl. Acad. Sci. USA 90:2207-2211 (1993).
RN [3]; RE0004730.
RX PUBMED: 8264594.
RA Hsu W., Kerppola T. K., Chen P.-L., Curran T., Chen-Kiang S.
RT Fos and Jun repress transcription activation by NF-IL6 through association at the basic zipper region
RL Mol. Cell. Biol. 14:268-276 (1994).
RN [4]; RE0006266.
RX PUBMED: 7935377.
RA Klampfer L., Lee T. H., Hsu W., Vilcek J., Chen-Kiang S.
RT NF-IL6 and AP-1 cooperatively modulate the activation of the TSG-6 gene by tumor necrosis factor alpha and interleukin-1
RL Mol. Cell. Biol. 14:6561-6569 (1994).
RN [5]; RE0007308.
RX PUBMED: 8455626.
RA Hsu W., Chen-Kiang S.
RT Convergent regulation of NF-Il6 and Oct-1 synthesis by interleukin-6 and retinoic acid signaling in embryonal carcinoma cells
RL Mol. Cell. Biol. 13:2515-2523 (1993).
RN [6]; RE0030566.
RX PUBMED: 12947119.
RA Zhang F., Lin M., Abidi P., Thiel G., Liu J.
RT Specific interaction of Egr1 and c/EBPbeta leads to the transcriptional activation of the human low density lipoprotein receptor gene.
RL J. Biol. Chem. 278:44246-54 (2003).
RN [7]; RE0044354.
RX PUBMED: 11773445.
RA Christian M., Pohnke Y., Kempf R., Gellersen B., Brosens J. J.
RT Functional association of PR and CCAAT/enhancer-binding protein beta isoforms: promoter-dependent cooperation between PR-B and liver-enriched inhibitory protein, or liver-enriched activatory protein and PR-A in human endometrial stromal cells
RL Mol. Endocrinol. 16:141-54 (2002).
RN [8]; RE0047933.
RX PUBMED: 10602039.
RA Hatada E. N., Chen-Kiang S., Scheidereit C.
RT Interaction and functional interference of C/EBPbeta with octamer factors in immunoglobulin gene transcription.
RL Eur. J. Immunol. 30:174-184 (2000).
RN [9]; RE0047995.
RX PUBMED: 10821850.
RA Choi Y., Asada S., Uesugi M.
RT Divergent hTAFII31-binding motifs hidden in activation domains.
RL J. Biol. Chem. 275:15912-15916 (2000).
RN [10]; RE0048275.
RX PUBMED: 16227626.
RA Schneider-Merck T., Pohnke Y., Kempf R., Christian M., Brosens J. J., Gellersen B.
RT Physical interaction and mutual transrepression between CCAAT/enhancer-binding protein beta and the p53 tumor suppressor.
RL J. Biol. Chem. 281:269-278 (2006).
RN [11]; RE0048287.
RX PUBMED: 12805554.
RA Newman J. R., Keating A. E.
RT Comprehensive identification of human bZIP interactions with coiled-coil arrays.
RL Science 300:2097-2101 (2003).
RN [12]; RE0048580.
RX PUBMED: 15928042.
RA Shimokawa T., Ra C.
RT C/EBPalpha functionally and physically interacts with GABP to activate the human myeloid IgA Fc receptor (Fc alphaR, CD89) gene promoter.
RL Blood 106:2534-2542 (2005).
RN [13]; RE0068544.
RX PUBMED: 18820298.
RA Wang W. L., Lee Y. C., Yang W. M., Chang W. C., Wang J. M.
RT Sumoylation of LAP1 is involved in the HDAC4-mediated repression of COX-2 transcription.
RL Nucleic Acids Res. 36:6066-6079 (2008).
RN [14]; RE0070802.
RX PUBMED: 18056453.
RA Yokota T., Bui T., Liu Y., Yi M., Hunt K. K., Keyomarsi K.
RT Differential regulation of elafin in normal and tumor-derived mammary epithelial cells is mediated by CCAAT/enhancer binding protein beta.
RL Cancer Res. 67:11272-11283 (2007).
XX
//