TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09526 XX ID T09526 XX DT 30.10.2006 (created); kau. CO Copyright (C), QIAGEN. XX FA CHOP-10-isoform1 XX SY C/EBP homologous protein 10; CHOP; CHOP-10; GADD 153; growth arrest and DNA-damage-inducible gene 153. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G009609 DDIT3; HGNC: DDIT3. XX CL C0008; bZIP. XX SZ 169 AA; 19.2 kDa (cDNA) (calc.). XX SQ MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASL SQ AWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRM SQ KEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA XX SC Swiss-Prot#P35638 XX FT 96 161 SM00338; brlzneu. FT 97 151 PF07716; Basic region leucine zipper. FT 99 162 PS50217; BZIP. XX IN T00167 ATF-2-isoform1; human, Homo sapiens. IN T01313 ATF-3-isoform1; human, Homo sapiens. IN T09531 ATF-4; human, Homo sapiens. IN T18798 ATFa-isoform3; human, Homo sapiens. IN T18808 B-ATF; human, Homo sapiens. IN T18804 batf3; human, Homo sapiens. IN T08776 c-Fos; human, Homo sapiens. IN T00105 C/EBPalpha; human, Homo sapiens. IN T06595 C/EBPbeta-FL; human, Homo sapiens. IN T09139 C/EBPdelta; human, Homo sapiens. IN T04883 C/EBPepsilon; human, Homo sapiens. IN T10891 C/EBPepsilon; Mammalia. IN T09524 C/EBPgamma; human, Homo sapiens. IN T09550 CREBPA-Alpha; human, Homo sapiens. IN T09554 DBP; human, Homo sapiens. IN T09569 Hlf-isoform1; human, Homo sapiens. IN T09572 MafG; human, Homo sapiens. IN T09555 MafK; human, Homo sapiens. IN T04876 TEF-xbb1; human, Homo sapiens. XX DR TRANSPATH: MO000089810. DR EMBL: S40706; S40706. DR UniProtKB: P35638; GA15_HUMAN. XX RN [1]; RE0001111. RX PUBMED: 1400365. RA Bartlett J. D., Luethy J. D., Carlson S. G., Sollott S. J., Holbrook N. J. RT Calcium ionophore A23187 induces expression of the growth arrest and DNA damage inducible CCAAT/enhancer-binding protein (C/EBP)-related gene gadd153 RL J. Biol. Chem. 267:20465-20470 (1992). RN [2]; RE0007049. RX PUBMED: 8125258. RA Barone M. V., Crozat A., Tabaee A., Philipson L., Ron D. RT CHOP (GADD153) and its oncogenic variant, TLS-CHOP, have opposing effects on the induction of G1/S arrest RL Genes Dev. 15:453-464 (1995). RN [3]; RE0048287. RX PUBMED: 12805554. RA Newman J. R., Keating A. E. RT Comprehensive identification of human bZIP interactions with coiled-coil arrays. RL Science 300:2097-2101 (2003). RN [4]; RE0066024. RX PUBMED: 15308577. RA Gery S., Park D. J., Vuong P. T., Chih D. Y., Lemp N., Koeffler H. P. RT Retinoic acid regulates C/EBP homologous protein expression (CHOP), which negatively regulates myeloid target genes. RL Blood 104:3911-3917 (2004). XX //