![TRANSFAC-Logo](/transfac_factor/images/logo_genexplain.png)
AC T01313
XX
ID T01313
XX
DT 22.10.1994 (created); ewi.
DT 17.06.2013 (updated); mkl.
CO Copyright (C), QIAGEN.
XX
FA ATF-3-isoform1
XX
SY activating transcription factor 3; ATF-3.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G002871 ATF3; HGNC: ATF3.
XX
CL C0008; bZIP; 1.1.2.2.1.1.
XX
SZ 181 AA; 20.6 kDa (cDNA) (calc.).
XX
SQ MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSS
SQ ALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEK
SQ LESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQ
SQ S
XX
SC Swiss-Prot#P18847-1
XX
FT 84 138
PF07716; Basic region leucine zipper.
FT 84 148
SM00338; brlzneu.
FT 86 149
PS50217; BZIP.
XX
SF splice variant: ATF-3-isoform1 deltaZip [2];
SF no interaction with Tax of HTLV-I;
SF associates only with NF-kappaB1/p50, but not with RelA/ p65 subunit of NF-kappaB [5];
SF can tolerate variations in the center of the binding sites if the flanking sequences are favorable [8];
XX
FF repressor, presumably by stabilizing binding of inhibitory factors [2];
FF a similar interaction and concomitant sequestration may lead to the activation of promoters which do not reveal ATF sites [2];
FF mediates gene activation synergistically with c-Jun in response to FGF / Ras and cAMP, but only the former enhances ATF-3-isoform1 protein levels [7];
FF induces Tax-dependent transactivation by a mechanism that is enhanced further by PKA [6];
FF anisomycin and cotransfection of ATF2 T01802 and c-Jun T00133 activates ATF-3-isoform1 expression [9];
FF repressor of TNF-alpha induced E-selectin gene expression [10];
FF autorepressor of its own gene [8] [11];
FF stress-induced expression by homocysteine [11];
FF may have a functional role in homocysteinemia-associated andothelial dysfunction [11];
FF plays a critical role in accelerating caspase protease activation and apoptosis [12];
XX
IN T00167 ATF-2-isoform1; human, Homo sapiens.
IN T01382 ATF-2; rat, Rattus norvegicus.
IN T09531 ATF-4; human, Homo sapiens.
IN T00051 ATF; human, Homo sapiens.
IN T18798 ATFa-isoform3; human, Homo sapiens.
IN T18804 batf3; human, Homo sapiens.
IN T00131 c-Jun; mouse, Mus musculus.
IN T00132 c-Jun; rat, Rattus norvegicus.
IN T00133 c-Jun; human, Homo sapiens.
IN T00134 c-Jun; chick, Gallus gallus.
IN T00135 c-Jun; hamster, Cricetulus sp.
IN T08461 c-Jun; human, Homo sapiens.
IN T09524 C/EBPgamma; human, Homo sapiens.
IN T09526 CHOP-10-isoform1; human, Homo sapiens.
IN T09550 CREBPA-Alpha; human, Homo sapiens.
IN T08491 JunB; human, Homo sapiens.
IN T08995 JunD; human, Homo sapiens.
IN T00593 NF-kappaB1-p50; human, Homo sapiens.
XX
MX M00513 V$ATF3_Q6.
MX M01863 V$ATF3_Q6_01.
MX M07313 V$ATF3_Q6_02.
MX M00981 V$CREBATF_Q6.
MX M00801 V$CREB_Q3.
XX
BS R03924.
BS R16636.
BS R16637.
BS R11477.
BS R11553.
BS R16691.
BS R01258.
BS R34851.
BS R11552.
BS R00777.
BS R00779.
BS R34855.
BS R01358.
XX
DR TRANSPATH: MO000025574.
DR EMBL: L19871;
DR UniProtKB: P18847-1;
XX
RN [1]; RE0000666.
RX PUBMED: 2516827.
RA Hai T., Liu F., Coukos W. J., Green M. R.
RT Transcription factor ATF cDNA clones: an extensive family of leucine zipper proteins able to selectively form DNA-binding heterodimers
RL Genes Dev. 3:2083-2090 (1989).
RN [2]; RE0001083.
RX PUBMED: 7515060.
RA Chen B. P. C., Liang G., Whelan J., Hai T.
RT ATF3 and ATF3deltaZip. Transcriptional repression versus activation by alternatively spliced isoforms
RL J. Biol. Chem. 269:15819-15826 (1994).
RN [3]; RE0002270.
RX PUBMED: 2835770.
RA Lin Y.-S., Green M. R.
RT Interaction of a common cellular transcription factor, ATF, with regulatory elements in both E1a- and cyclic AMP-inducible promoters
RL Proc. Natl. Acad. Sci. USA 85:3396-3400 (1988).
RN [4]; RE0002561.
RX PUBMED: 1827203.
RA Hai T., Curran T.
RT Cross-family dimerization of transcription factors Fos/Jun and ATF/CREB alters DNA binding specificity
RL Proc. Natl. Acad. Sci. USA 88:3720-3724 (1991).
RN [5]; RE0004521.
RX PUBMED: 7692236.
RA Kaszubska W., Hooft van Huijsduijnen R., Ghersa P., DeRaemy-Schenk A.-M., Chen B. P. C., Hai T., DeLamarter J. F., Whelan J.
RT Cyclic AMP-independent ATF family members interact with NF-kappaB and function in the activation of the E-selectin promoter in response to cytokines
RL Mol. Cell. Biol. 13:7180-7190 (1993).
RN [6]; RE0006674.
RX PUBMED: 8007991.
RA Low K. G., Chu H.-M., Tan Y., Schwartz P. M., Daniels G. M., Melner M. H., Comb M. J.
RT Novel interactions between human T-cell leukemia virus type I Tax and activating transcription factor 3 at a cyclic AMP-responsive element
RL Mol. Cell. Biol. 14:4958-4974 (1994).
RN [7]; RE0006675.
RX PUBMED: 7935470.
RA Tan Y., Low K. G., Boccia C., Grossman J., Comb M. J.
RT Fibroblast growth factor and cyclic AMP (cAMP) synergistically activate gene expression at a cAMP response element
RL Mol. Cell. Biol. 14:7546-7556 (1994).
RN [8]; RE0017052.
RX PUBMED: 10748147.
RA Wolfgang C. D., Liang G., Okamoto Y., Allen A. E., Hai T.
RT Transcriptional autorepression of the stress-inducible gene ATF3
RL J. Biol. Chem. 275:16865-16870 (2000).
RN [9]; RE0017054.
RX PUBMED: 8576171.
RA Liang G., Wolfgang C. D., Chen B. P., Chen T. H., Hai T.
RT ATF3 gene. Genomic organization, promoter, and regulation.
RL J. Biol. Chem. 271:1695-1701 (1996).
RN [10]; RE0017057.
RX PUBMED: 10964678.
RA Nawa T., Nawa M. T., Cai Y., Zhang C., Uchimura I., Narumi S., Numano F., Kitajima S.
RT Repression of TNF-alpha-induced E-selectin expression by PPAR activators: involvement of transcriptional repressor LRF-1/ATF3
RL Biochem. Biophys. Res. Commun. 275:406-411 (2000).
RN [11]; RE0017058.
RX PUBMED: 10979959.
RA Cai Y., Zhang C., Nawa T., Aso T., Tanaka M., Oshiro S., Ichijo H., Kitajima S.
RT Homocysteine-responsive ATF3 gene expression in human vascular endothelial cells: activation of c-Jun NH(2)-terminal kinase and promoter response element
RL Blood 96:2140-2148 (2000).
RN [12]; RE0017063.
RX PUBMED: 11473362.
RA Mashima T., Udagawa S., Tsuruo T.
RT Involvement of transcriptional repressor ATF3 in acceleration of caspase protease activation during DNA damaging agent-induced apoptosis
RL J. Cell. Physiol. 188:352-358 (2001).
RN [13]; RE0048287.
RX PUBMED: 12805554.
RA Newman J. R., Keating A. E.
RT Comprehensive identification of human bZIP interactions with coiled-coil arrays.
RL Science 300:2097-2101 (2003).
XX
//