TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T08461 XX ID T08461 XX DT 23.01.2006 (created); res. DT 17.06.2016 (updated); ros. CO Copyright (C), QIAGEN. XX FA c-Jun XX SY AP1; c-Jun; JunA; p39; p39-jun. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G000219 JUN; HGNC: JUN. XX CL C0008; bZIP. XX SZ 331 AA; 35.7 kDa (cDNA) (calc.), 39-40 kDa (SDS) [31] XX SQ MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL SQ LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE SQ LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA SQ LSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETP SQ PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM SQ LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF XX SC Swiss-Prot#P05412 XX FT 5 241 PF03957; Jun-like transcription factor. FT 6 297 PF00478; IMP dehydrogenase / GMP reductase domain. FT 31 57 inhibitory delta region (missing in v-Jun) [1]. FT 63 63 Ser-phosphorylation [6]. FT 63 63 Ser-phosphorylation [7]. FT 73 73 Ser-phosphorylation [6]. FT 73 73 Ser-phosphorylation [7]. FT 92 110 trans-activation domain a1 [4]. FT 92 154 trans-activation domain A1 [4]. FT 96 193 binding to coactivator p300 [30]. FT 111 154 transcription regulatory domain epsilon [4]. FT 176 331 interactions with Sp1 [28]. FT 227 248 essential for trans-activation [1]. FT 230 251 trans-activation domain A2 [1]. FT 230 251 trans-activation domain A2 [3]. FT 230 251 trans-activation domain A2 [4]. FT 231 231 Thr-phosphorylation [5]. FT 231 231 Thr-phosphorylation [2]. FT 239 239 Thr-phosphorylation [5]. FT 239 239 Thr-phosphorylation [2]. FT 243 243 Ser-phosphorylation [5]. FT 243 243 Ser-phosphorylation [2]. FT 249 249 Ser-phosphorylation [5]. FT 249 249 Ser-phosphorylation [2]. FT 250 314 PF00170; bZIP transcription factor. FT 250 314 SM00338; brlzneu. FT 252 315 PS50217; BZIP. FT 308 331 SMAD-binding site [29]. XX IN T00167 ATF-2-isoform1; human, Homo sapiens. IN T01313 ATF-3-isoform1; human, Homo sapiens. IN T18798 ATFa-isoform3; human, Homo sapiens. IN T18808 B-ATF; human, Homo sapiens. IN T18804 batf3; human, Homo sapiens. IN T08776 c-Fos; human, Homo sapiens. IN T00108 C/EBPalpha-isoform1; rat, Rattus norvegicus. IN T00105 C/EBPalpha; human, Homo sapiens. IN T10310 COUP-TF2; Mammalia. IN T09550 CREBPA-Alpha; human, Homo sapiens. IN T05984 FosB; human, Homo sapiens. IN T08989 Fra-1-isoform1; human, Homo sapiens. IN T08990 Fra-2-isoform1; human, Homo sapiens. IN T09569 Hlf-isoform1; human, Homo sapiens. IN T09240 HOXD12; chick, Gallus gallus. IN T08995 JunD; human, Homo sapiens. IN T09572 MafG; human, Homo sapiens. IN T09555 MafK; human, Homo sapiens. IN T01443 Nrf2; human, Homo sapiens. IN T10042 Pit-1; Mammalia. IN T10429 PU.1; mouse, Mus musculus. IN T30231 SIRT1-isoform1; human, Homo sapiens. XX MX M00172 V$AP1FJ_Q2. MX M00517 V$AP1_01. MX M02280 V$AP1_02. MX M00924 V$AP1_Q2_01. MX M00926 V$AP1_Q4_01. MX M00925 V$AP1_Q6_01. MX M03541 V$CJUN_Q6. MX M00041 V$CREBP1CJUN_01. XX BS R00352. BS R03910. BS R03924. BS R03909. BS R04112. BS R59733. BS R59726. BS R71679. BS R71680. BS R04348. BS R26710. BS R04127. BS R26909. BS R00455. BS R35816. BS R14721. BS R13244. BS R13245. BS R23188. BS R22657. BS R67301. BS R67302. BS R37765. BS R04330. BS R38461. BS R63071. BS R14470. BS R03102. BS R32839. BS R02952. BS R05036. BS R05050. BS R05052. BS R05079. BS R04394. BS R13230. BS R16333. XX DR TRANSPATH: MO000058322. DR EMBL: J04111; DR UniProtKB: P05412; DR PDB: 1FOS. DR PDB: 1JUN. XX RN [1]; RE0000124. RX PUBMED: 2510934. RA Bohmann D., Tjian R. RT Biochemical analysis of transcriptional activation by Jun: Differential activity of c- and v-Jun RL Cell 59:709-717 (1989). RN [2]; RE0000157. RX PUBMED: 1846781. RA Boyle W. J., Smeal T., Defize L. H. K., Angel P., Woodgett G. R., Karin M., Hunter T. RT Activation of protein kinase C decreases phosphorylation of c-Jun at sites that negatively regulate its DNA-binding activity RL Cell 64:573-584 (1991). RN [3]; RE0004657. RX PUBMED: 2121368. RA Baichwal V. R., Tjian R. RT Control of c-Jun activity by interaction of a cell-specific inhibitor with regulatory domain delta: Differences between v- and c-Jun RL Cell 63:815-825 (1990). RN [4]; RE0004661. RX PUBMED: 1644291. RA Baichwal V. R., Park A., Tjian R. RT The cell-type-specific activator region of c-Jun juxtaposes constitutive and negatively regulated domains RL Genes Dev. 6:1493-1502 (1992). RN [5]; RE0004667. RX PUBMED: 8464713. RA Bannister A. J., Gottlieb T. M., Kouzarides T., Jackson S. P. RT c-Jun is phosphorylated by the DNA-dependent protein kinase in vitro; definition of the minimal kinase recognition motif RL Nucleic Acids Res. 21:1289-1295 (1993). RN [6]; RE0004678. RX PUBMED: 1903181. RA Binetruy B., Smeal T., Karin M. RT Ha-Ras augments c-Jun activity and stimulates phosphorylation of its activation domain RL Nature 351:122-127 (1991). RN [7]; RE0004706. RX PUBMED: 1906140. RA Baichwal V. R., Park A., Tjian R. RT v-Src and EJ Ras alleviate repression of c-jun by a cell-specific inhibitor RL Nature 352:165-168 (1991). RN [8]; RE0031925. RX PUBMED: 12377781. RA Yoshida K., Miki Y., Kufe D. RT Activation of SAPK/JNK signaling by protein kinase Cdelta in response to DNA damage. RL J. Biol. Chem. 277:48372-8 (2002). RN [9]; RE0041444. RX PUBMED: 11934895. RA Lin F., Kolluri S. K., Chen G. Q., Zhang X. K. RT Regulation of retinoic acid-induced inhibition of AP-1 activity by orphan receptor chicken ovalbumin upstream promoter-transcription factor RL J. Biol. Chem. 277:21414-22 (2002). RN [10]; RE0046520. RX PUBMED: 10567391. RA Kabe Y., Goto M., Shima D., Imai T., Wada T., Morohashi K., Shirakawa M., Hirose S., Handa H. RT The role of human MBF1 as a transcriptional coactivator RL J. Biol. Chem. 274:34196-202 (1999). RN [11]; RE0047467. RX PUBMED: 8663380. RA Farrow K. N., Manning N., Schaufele F., Gutierrez-Hartmann A. RT The c-Jun delta-domain inhibits neuroendocrine promoter activity in a DNA sequence- and pituitary-specific manner. RL J. Biol. Chem. 271:17139-17146 (1996). RN [12]; RE0047473. RX PUBMED: 9988737. RA Behre G., Whitmarsh A. J., Coghlan M. P., Hoang T., Carpenter C. L., Zhang D. E., Davis R. J., Tenen D. G. RT c-Jun is a JNK-independent coactivator of the PU.1 transcription factor. RL J. Biol. Chem. 274:4939-4946 (1999). RN [13]; RE0047597. RX PUBMED: 15753034. RA Jaffe A. B., Hall A., Schmidt A. RT Association of CNK1 with Rho guanine nucleotide exchange factors controls signaling specificity downstream of Rho. RL Curr. Biol. 15:405-412 (2005). RN [14]; RE0047801. RX PUBMED: 15626733. RA Salomoni P., Bernardi R., Bergmann S., Changou A., Tuttle S., Pandolfi P. P. RT The promyelocytic leukemia protein PML regulates c-Jun function in response to DNA damage. RL Blood 105:3686-3690 (2005). RN [15]; RE0047872. RX PUBMED: 9685505. RA Yamaguchi Y., Wada T., Suzuki F., Takagi T., Hasegawa J., Handa H. RT Casein kinase II interacts with the bZIP domains of several transcription factors. RL Nucleic Acids Res. 26:3854-3861 (1998). RN [16]; RE0047971. RX PUBMED: 11036080. RA Kataoka K., Yoshitomo-Nakagawa K., Shioda S., Nishizawa M. RT A set of Hox proteins interact with the Maf oncoprotein to inhibit its DNA binding, transactivation, and transforming activities. RL J. Biol. Chem. 276:819-826 (2001). RN [17]; RE0048287. RX PUBMED: 12805554. RA Newman J. R., Keating A. E. RT Comprehensive identification of human bZIP interactions with coiled-coil arrays. RL Science 300:2097-2101 (2003). RN [18]; RE0048459. RX PUBMED: 12091339. RA Reddy V. A., Iwama A., Iotzova G., Schulz M., Elsasser A., Vangala R. K., Tenen D. G., Hiddemann W., Behre G. RT Granulocyte inducer C/EBPalpha inactivates the myeloid master regulator PU.1: possible role in lineage commitment decisions. RL Blood 100:483-490 (2002). RN [19]; RE0049113. RX PUBMED: 16397300. RA Wang J. M., Ko C. Y., Chen L. C., Wang W. L., Chang W. C. RT Functional role of NF-IL6beta and its sumoylation and acetylation modifications in promoter activation of cyclooxygenase 2 gene. RL Nucleic Acids Res. 34:217-231 (2006). RN [20]; RE0049579. RX PUBMED: 16533805. RA Ho D. T., Bardwell A. J., Grewal S., Iverson C., Bardwell L. RT Interacting JNK-docking sites in MKK7 promote binding and activation of JNK mitogen-activated protein kinases. RL J. Biol. Chem. 281:13169-13179 (2006). RN [21]; RE0049925. RX PUBMED: 11689449. RA Vries R. G., Prudenziati M., Zwartjes C., Verlaan M., Kalkhoven E., Zantema A. RT A specific lysine in c-Jun is required for transcriptional repression by E1A and is acetylated by p300. RL EMBO J. 20:6095-6103 (2001). RN [22]; RE0051324. RX PUBMED: 14532268. RA Perez-Sala D., Cernuda-Morollon E., Canada F. J. RT Molecular basis for the direct inhibition of AP-1 DNA binding by 15-deoxy-Delta 12,14-prostaglandin J2. RL J. Biol. Chem. 278:51251-51260 (2003). RN [23]; RE0055094. RX PUBMED: 17359934. RA Waldron R. T., Whitelegge J. P., Faull K. F., Rozengurt E. RT Identification of a novel phosphorylation site in c-jun directly targeted in vitro by protein kinase D. RL Biochem. Biophys. Res. Commun. 356:361-367 (2007). RN [24]; RE0055097. RX PUBMED: 11533064. RA Wilson M. P., Sun Y., Cao L., Majerus P. W. RT Inositol 1,3,4-trisphosphate 5/6-kinase is a protein kinase that phosphorylates the transcription factors c-Jun and ATF-2. RL J. Biol. Chem. 276:40998-41004 (2001). RN [25]; RE0055309. RX PUBMED: 17875734. RA Chen D., Reierstad S., Lin Z., Lu M., Brooks C., Li N., Innes J., Bulun S. E. RT Prostaglandin E(2) induces breast cancer related aromatase promoters via activation of p38 and c-Jun NH(2)-terminal kinase in adipose fibroblasts. RL Cancer Res. 67:8914-8922 (2007). RN [26]; RE0066089. RX PUBMED: 20042607. RA Zhang R., Chen H. Z., Liu J. J., Jia Y. Y., Zhang Z. Q., Yang R. F., Zhang Y., Xu J., Wei Y. S., Liu D. P., Liang C. C. RT SIRT1 Suppresses Activator Protein-1 Transcriptional Activity and Cyclooxygenase-2 Expression in Macrophages. RL J. Biol. Chem. 285:7097-7110 (2010). RN [27]; RE0067950. RX PUBMED: 1332698. RA Hughes K., Ramakrishna S., Benjamin W. B., Woodgett J. R. RT Identification of multifunctional ATP-citrate lyase kinase as the alpha-isoform of glycogen synthase kinase-3. RL Biochem. J. 288:309-314 (1992). RN [28]; RE0024063. RX PUBMED: 10506225. RA Kardassis D., Papakosta P., Pardali K., Moustakas A. RT c-Jun transactivates the promoter of the human p21(WAF1/Cip1) gene by acting as a superactivator of the ubiquitous transcription factor Sp1. RL J. Biol. Chem. 274:29572-29581 (1999). RN [29]; RE0016071. RX PUBMED: 10220381. RA Liberati N. T., Datto M. B., Frederick J. P., Shen X., Wong C., Rougier-Chapman E. M., Wang X. F. RT Smads bind directly to the Jun family of AP-1 transcription factors. RL Proc. Natl. Acad. Sci. USA 96:4844-4849 (1999). RN [30]; RE0018232. RX PUBMED: 8754832. RA Lee J. S., See R. H., Deng T., Shi Y. RT Adenovirus E1A downregulates cJun- and JunB-mediated transcription by targeting their coactivator p300. RL Mol. Cell. Biol. 16:4312-4326 (1996). RN [31]; RE0004649. RX PUBMED: 3130660. RA Rauscher III F. J., Cohen D. R., Curran T., Bos T. J., Vogt P. K., Bohmann D., Tjian R., Franza jr B. R. RT Fos-associated protein p39 is the product of the jun proto-oncogene RL Science 240:1010-1016 (1988). XX //