TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T08995 XX ID T08995 XX DT 05.06.2006 (created); kau. DT 06.02.2013 (updated); spk. CO Copyright (C), QIAGEN. XX FA JunD XX SY AP-1; Jun-D; TRANSCRIPTION FACTOR JUN-D. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G006330 JUND; HGNC: JUND. XX CL C0008; bZIP. XX SZ 347 AA; 35.2 kDa (cDNA) (calc.), 35.4 kDa, 40-50 kDa (SDS) XX SQ METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAA SQ ALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTS SQ SQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPG SQ ELAPAAAAPEAPVYANLSSYAGGAGGAGGAATVAFAAEPVPFPPPPPPGALGPPRLAALK SQ DEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKV SQ KTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY XX SC Swiss-Prot#P17535 XX FT 1 257 PF03957; Jun-like transcription factor. FT 9 345 PF00478; IMP dehydrogenase / GMP reductase domain. FT 266 330 PF00170; bZIP transcription factor. FT 266 330 SM00338; brlzneu. FT 268 331 PS50217; BZIP. XX IN T00167 ATF-2-isoform1; human, Homo sapiens. IN T01313 ATF-3-isoform1; human, Homo sapiens. IN T18798 ATFa-isoform3; human, Homo sapiens. IN T18808 B-ATF; human, Homo sapiens. IN T18804 batf3; human, Homo sapiens. IN T08776 c-Fos; human, Homo sapiens. IN T08461 c-Jun; human, Homo sapiens. IN T09550 CREBPA-Alpha; human, Homo sapiens. IN T05984 FosB; human, Homo sapiens. IN T08989 Fra-1-isoform1; human, Homo sapiens. IN T08990 Fra-2-isoform1; human, Homo sapiens. IN T09555 MafK; human, Homo sapiens. XX MX M00517 V$AP1_01. MX M00924 V$AP1_Q2_01. MX M00926 V$AP1_Q4_01. MX M00925 V$AP1_Q6_01. MX M03552 V$JUND_Q6. XX DR TRANSPATH: MO000082456. DR EMBL: X51346; DR EMBL: X56681; DR UniProtKB: P17535; XX RN [1]; RE0003225. RX PUBMED: 1313772. RA Li L., Chambard J. C., Karin M., Olson E. N. RT Fos and Jun repress transcriptional activation by myogenin and MyoD: the amino terminus of Jun can mediate repression RL Genes Dev. 6:676-689 (1992). RN [2]; RE0004784. RX PUBMED: 2112242. RA Nomura N., Ide M., Sasamoto S., Matsui M., Date T., Ishizaki R. RT Isolation of human cDNA clones of jun-related genes, jun-B and jun-D RL Nucleic Acids Res. 18:3047-3048 (1990). RN [3]; RE0004786. RX PUBMED: 1903194. RA Berger I., Shaul Y. RT Structure and function of human jun-D RL Oncogene 6:561-566 (1991). RN [4]; RE0004788. RX PUBMED: 8415709. RA Kameda T., Akahori A., Sonobe M. H., Suzuki T., Endo T., Iba H. RT JunD mutants with spontaneously acquired transforming potential have enhanced transactivating activity in combination with Fra-2 RL Proc. Natl. Acad. Sci. USA 90:9369-9373 (1993). RN [5]; RE0013940. RX PUBMED: 10454570. RA Cirillo G., Casalino L., Vallone D., Caracciolo A., De Cesare D., Verde P. RT Role of distinct mitogen-activated protein kinase pathways and cooperation between Ets-2, ATF-2, and Jun family members in human urokinase-type plasminogen activator gene induction by interleukin-1 and tetradecanoyl phorbol acetate RL Mol. Cell. Biol. 19:6340-6252 (1999). RN [6]; RE0048287. RX PUBMED: 12805554. RA Newman J. R., Keating A. E. RT Comprehensive identification of human bZIP interactions with coiled-coil arrays. RL Science 300:2097-2101 (2003). XX //