TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T08990 XX ID T08990 XX DT 05.06.2006 (created); kau. DT 28.08.2007 (updated); tgo. CO Copyright (C), QIAGEN. XX FA Fra-2-isoform1 XX SY Fos related antigen 2; Fos-like antigen 2; FOSL2; Fra2. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G004688 FOSL2; HGNC: FOSL2. XX CL C0008; bZIP. XX SZ 326 AA; 35.2 kDa (cDNA) (calc.). XX SQ MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQQKFRVDMPGSGSAFIPTINAITTSQDL SQ QWMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLS SQ PEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKL SQ EFMLVAHGPVCKISPEERRSPPAPGLQPMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDK SQ AQRSVIKPISIAGGFYGEEPLHTPIVVTSTPAVTPGTSNLVFTYPSVLEQESPASPSESC SQ SKAHRRSSSSGDQSSDSLNSPTLLAL XX SC Swiss-Prot#P15408 XX FT 122 186 PF00170; bZIP transcription factor. FT 122 186 SM00338; brlzneu. FT 124 187 PS50217; BZIP. XX IN T00167 ATF-2-isoform1; human, Homo sapiens. IN T18798 ATFa-isoform3; human, Homo sapiens. IN T08776 c-Fos; human, Homo sapiens. IN T08461 c-Jun; human, Homo sapiens. IN T09550 CREBPA-Alpha; human, Homo sapiens. IN T08491 JunB; human, Homo sapiens. IN T08995 JunD; human, Homo sapiens. IN T09646 MafB; human, Homo sapiens. XX MX M00924 V$AP1_Q2_01. MX M00926 V$AP1_Q4_01. MX M00925 V$AP1_Q6_01. MX M03870 V$FRA2_Q4_01. XX DR TRANSPATH: MO000082443. DR EMBL: X16706; DR UniProtKB: P15408; XX RN [1]; RE0004643. RX PUBMED: 8355695. RA Kerppola T. K., Curran T. RT Selective DNA bending by a variety of bZIP proteins RL Mol. Cell. Biol. 13:5479-5489 (1993). RN [2]; RE0004788. RX PUBMED: 8415709. RA Kameda T., Akahori A., Sonobe M. H., Suzuki T., Endo T., Iba H. RT JunD mutants with spontaneously acquired transforming potential have enhanced transactivating activity in combination with Fra-2 RL Proc. Natl. Acad. Sci. USA 90:9369-9373 (1993). RN [3]; RE0004817. RX PUBMED: 7504176. RA Wisdom R., Verma I. M. RT Transformation by Fos proteins requires a C-terminal transactivation domain RL Mol. Cell. Biol. 13:7429-7438 (1993). RN [4]; RE0004865. RX PUBMED: 1406676. RA Kovary K., Bravo R. RT Existence of different Fos/Jun complexes during the G0-to-G1 transition and during exponential growth in mouse fibroblasts: differential role of Fos proteins RL Mol. Cell. Biol. 12:5015-5023 (1992). RN [5]; RE0004893. RX PUBMED: 2107490. RA Matsui M., Tokuhara M., Konuma Y., Nomura N., Ishizaki R. RT Isolation of human fos- related genes and their expression during monocyte-macrophage differentiation RL Oncogene 5:249-255 (1990). RN [6]; RE0048287. RX PUBMED: 12805554. RA Newman J. R., Keating A. E. RT Comprehensive identification of human bZIP interactions with coiled-coil arrays. RL Science 300:2097-2101 (2003). XX //