AC T08989
XX
ID T08989
XX
DT 05.06.2006 (created); kau.
CO Copyright (C), QIAGEN.
XX
FA Fra-1-isoform1
XX
SY FOS-like antigen 1; FOSL1; Fra-1; FraI.
XX
OS human, Homo sapiens
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates
XX
GE G001636 FOSL1; HGNC: FOSL1.
XX
CL C0008; bZIP.
XX
SZ 271 AA; 29.4 kDa (cDNA) (calc.).
XX
SQ MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLG
SQ PSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAA
SQ KCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKE
SQ GDTGSTSGTSSPPAPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPST
SQ PEPCASAHRKSSSSSGDPSSDPLGSPTLLAL
XX
SC translated from EMBL:BC016648
XX
FT 103 167 
PF00170; bZIP transcription factor.
FT 103 167 
SM00338; brlzneu.
FT 105 168 
PS50217; BZIP.
XX
IN T00167 ATF-2-isoform1; human, Homo sapiens.
IN T18798 ATFa-isoform3; human, Homo sapiens.
IN T08461 c-Jun; human, Homo sapiens.
IN T08587 c-Jun; mouse, Mus musculus.
IN T09550 CREBPA-Alpha; human, Homo sapiens.
IN T05984 FosB; human, Homo sapiens.
IN T08491 JunB; human, Homo sapiens.
IN T08590 JunB; mouse, Mus musculus.
IN T08995 JunD; human, Homo sapiens.
IN T09646 MafB; human, Homo sapiens.
XX
MX M00517 V$AP1_01.
MX M00924 V$AP1_Q2_01.
MX M00926 V$AP1_Q4_01.
MX M00925 V$AP1_Q6_01.
MX M01267 V$FRA1_Q5.
MX M02095 V$FRA1_Q6.
MX M03869 V$FRA1_Q6_01.
XX
BS R05035.
BS R16319.
BS R02952.
BS R05036.
BS R05050.
BS R05052.
XX
DR TRANSPATH: MO000082439.
DR EMBL: D14493;
DR EMBL: D16365;
DR EMBL: X16707;
DR UniProtKB: P15407;
XX
RN [1]; RE0002956.
RX PUBMED: 1328861.
RA Trejo J., Chambard J.-C., Karin M., Brown J. H.
RT Biphasic increase in c-jun mRNA is required for induction of AP-1-mediated gene transcription: Differential effects of muscarinic and thrombin receptor activation
RL Mol. Cell. Biol. 12:4742- 4750 (1992).
RN [2]; RE0004628.
RX PUBMED: 8441422.
RA Boise L., Petryniak B., Mao X., June C. H., Wang C.-Y., Lindsten T., Bravo R., Kovary K., Leiden J., Thompson C. B.
RT The NFAT-1 DNA binding complex in activated T cells contains Fra-1 and JunB
RL Mol. Cell. Biol. 13:1911-1919 (1993).
RN [3]; RE0004824.
RX PUBMED: 8065335.
RA Metz R., Bannister A. J., Sutherland J. A., Hagemeier C., O'Rourke E. C., Cook A., Bravo R., Kouzarides T.
RT c-Fos-induced activation of a TATA-box-containing promoter involves direct contact with TATA-box-binding protein
RL Mol. Cell. Biol. 14:6021-6029 (1994).
RN [4]; RE0004893.
RX PUBMED: 2107490.
RA Matsui M., Tokuhara M., Konuma Y., Nomura N., Ishizaki R.
RT Isolation of human fos- related genes and their expression during monocyte-macrophage differentiation
RL Oncogene 5:249-255 (1990).
RN [5]; RE0004894.
RX PUBMED: 8230424.
RA Tsuchiya H., Fujii M., Niki T., Tokuhara M., Matsui M., Seiki M.
RT Human T-cell leukemia virus type 1 Tax activates transcription of the human fra-1 gene through multiple cis elements responsive to transmembrane signals
RL J. Virol. 67:7001-7007 (1993).
RN [6]; RE0013940.
RX PUBMED: 10454570.
RA Cirillo G., Casalino L., Vallone D., Caracciolo A., De Cesare D., Verde P.
RT Role of distinct mitogen-activated protein kinase pathways and cooperation between Ets-2, ATF-2, and Jun family members in human urokinase-type plasminogen activator gene induction by interleukin-1 and tetradecanoyl phorbol acetate
RL Mol. Cell. Biol. 19:6340-6252 (1999).
RN [7]; RE0023779.
RX PUBMED: 13679379.
RA Adiseshaiah P., Papaiahgari S. R., Vuong H., Kalvakolanu D. V., Reddy S. P.
RT Multiple cis-elements mediate the transcriptional activation of human fra-1 by 12-O-tetradecanoylphorbol-13-acetate in bronchial epithelial cells.
RL J. Biol. Chem. 278:47423-47433 (2003).
RN [8]; RE0048287.
RX PUBMED: 12805554.
RA Newman J. R., Keating A. E.
RT Comprehensive identification of human bZIP interactions with coiled-coil arrays.
RL Science 300:2097-2101 (2003).
RN [9]; RE0066145.
RX PUBMED: 20053986.
RA Malnou C. E., Brockly F., Favard C., Moquet-Torcy G., Piechaczyk M., Jariel-Encontre I.
RT Heterodimerization with different Jun proteins controls c-Fos intranuclear dynamics and distribution.
RL J. Biol. Chem. 285:6552-6562 (2010).
XX
//