AC T08587
XX
ID T08587
XX
DT 21.02.2006 (created); kau.
DT 22.04.2014 (updated); jmh.
CO Copyright (C), QIAGEN.
XX
FA c-Jun
XX
SY AH119; AP-1; c-Jun; Jun; JunA; p39; proto-oncogene Jun A; transcription factor c-Jun.
XX
OS mouse, Mus musculus
OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae
XX
GE G000487 Jun.
XX
CL C0008; bZIP.
XX
SZ 334 AA; 35.9 kDa (cDNA) (calc.), 40 kDa (SDS)
XX
SQ MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
SQ LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
SQ LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGAGGGGGYSASLHSEPPVYANLSNFNPGA
SQ LSSGGGAPSYGAAGLAFPSQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPG
SQ ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST
SQ ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
XX
SC translated from EMBL:J04115
XX
FT 5 244 
PF03957; Jun-like transcription factor.
FT 6 300 
PF00478; IMP dehydrogenase / GMP reductase domain.
FT 63 63 
Ser-phosphorylation [9].
FT 63 63 
Ser-phosphorylation [11].
FT 73 73 
Ser-phosphorylation [9].
FT 73 73 
Ser-phosphorylation [11].
FT 92 154 
trans-activation domain A1 [10].
FT 190 224 
ancillary DNA-binding region [10].
FT 253 317 
PF00170; bZIP transcription factor.
FT 253 317 
SM00338; brlzneu.
FT 255 318 PS50217; BZIP.
XX
IN T08444 ATF-4; mouse, Mus musculus.
IN T08495 c-Ets-1; human, Homo sapiens.
IN T08493 c-Fos; rat, Rattus norvegicus.
IN T08534 c-Fos; mouse, Mus musculus.
IN T08776 c-Fos; human, Homo sapiens.
IN T08988 Elf-1-isoform1; human, Homo sapiens.
IN T08300 ER-alpha-L; human, Homo sapiens.
IN T02066 Fli-1; human, Homo sapiens.
IN T08989 Fra-1-isoform1; human, Homo sapiens.
IN T08862 pitx1; mouse, Mus musculus.
IN T00702 PU.1; mouse, Mus musculus.
XX
MX M00172 V$AP1FJ_Q2.
MX M00517 V$AP1_01.
MX M00924 V$AP1_Q2_01.
MX M00926 V$AP1_Q4_01.
MX M00925 V$AP1_Q6_01.
MX M03541 V$CJUN_Q6.
MX M00041 V$CREBP1CJUN_01.
XX
BS R26674.
BS R37247.
BS R13583.
BS R57920.
BS R04032.
BS R21509.
BS R61425.
BS R61424.
BS R38893.
BS R26821.
XX
DR TRANSPATH: MO000078288.
DR EMBL: J04115;
DR EMBL: X12740;
DR EMBL: X12761;
DR UniProtKB: P05627;
XX
RN [1]; RE0005544.
RX PUBMED: 1631061.
RA Chevray P. M., Nathans D.
RT Protein interaction cloning in yeast: identification of mammalian proteins that react with the leucine zipper of Jun
RL Proc. Natl. Acad. Sci. USA 89:5789-5793 (1992).
RN [2]; RE0016689.
RX PUBMED: 7648395.
RA Bassuk A. G., Leiden J. M.
RT A direct physical association between ETS and AP-1 transcription factors in normal human T cells.
RL Immunity 3:223-237 (1995).
RN [3]; RE0031549.
RX PUBMED: 11477071.
RA Teyssier C., Belguise K., Galtier F., Chalbos D.
RT Characterization of the physical interaction between estrogen receptor alpha and JUN proteins.
RL J. Biol. Chem. 276:36361-9 (2001).
RN [4]; RE0047640.
RX PUBMED: 15226417.
RA Jeong K. H., Chin W. W., Kaiser U. B.
RT Essential role of the homeodomain for pituitary homeobox 1 activation of mouse gonadotropin-releasing hormone receptor gene expression through interactions with c-Jun and DNA.
RL Mol. Cell. Biol. 24:6127-6139 (2004).
RN [5]; RE0053117.
RX PUBMED: 15312241.
RA Kondo T., Kitazawa R., Maeda S., Kitazawa S.
RT 1 alpha,25 dihydroxyvitamin D3 rapidly regulates the mouse osteoprotegerin gene through dual pathways.
RL J. Bone Miner. Res. 19:1411-1419 (2004).
RN [6]; RE0064558.
RX PUBMED: 17724032.
RA Qi X., Pohl N. M., Loesch M., Hou S., Li R., Qin J. Z., Cuenda A., Chen G.
RT p38alpha antagonizes p38gamma activity through c-Jun-dependent ubiquitin-proteasome pathways in regulating Ras transformation and stress response.
RL J. Biol. Chem. 282:31398-31408 (2007).
RN [7]; RE0066145.
RX PUBMED: 20053986.
RA Malnou C. E., Brockly F., Favard C., Moquet-Torcy G., Piechaczyk M., Jariel-Encontre I.
RT Heterodimerization with different Jun proteins controls c-Fos intranuclear dynamics and distribution.
RL J. Biol. Chem. 285:6552-6562 (2010).
RN [8]; RE0070354.
RX PUBMED: 9637499.
RA Krautwald S.
RT IL-16 activates the SAPK signaling pathway in CD4+ macrophages.
RL J. Immunol. 160:5874-5879 (1998).
RN [9]; RE0004678.
RX PUBMED: 1903181.
RA Binetruy B., Smeal T., Karin M.
RT Ha-Ras augments c-Jun activity and stimulates phosphorylation of its activation domain
RL Nature 351:122-127 (1991).
RN [10]; RE0004659.
RX PUBMED: 1904542.
RA Abate C., Luk D., Curran T.
RT Transcriptional regulation by Fos and Jun in vitro: Interaction among multiple activator and regulator domains
RL Mol. Cell. Biol. 11:3624-3632 (1991).
RN [11]; RE0004706.
RX PUBMED: 1906140.
RA Baichwal V. R., Park A., Tjian R.
RT v-Src and EJ Ras alleviate repression of c-jun by a cell-specific inhibitor
RL Nature 352:165-168 (1991).
XX
//