TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T08862 XX ID T08862 XX DT 26.04.2006 (created); kau. DT 02.03.2012 (updated); pos. CO Copyright (C), QIAGEN. XX FA pitx1 XX SY Bft (Backfoot); P-OTX; P-Otx (Pituarity Otx related factor); Pituarity homeobox 1; Pituitary Homeobox factor 1, Pitx1; Ptx-1; Ptx1. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G006561 Pitx1. XX CL C0006; homeo. XX SZ 315 AA; 34.0 kDa (cDNA) (calc.). XX SQ MDAFKGGMSLERLPEGLRPPPPPPHDMGPSFHLARAADPREPLENSASESSDADLPDKER SQ GGEAKGPEDGGAGSAGCGGGAEDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMR SQ EEIAVWTNLTEPRVRVWFKNRRAKWRKRERNQQLDLCKGGYVPQFSGLVQPYEDVYAAGY SQ SYNNWAAKSLAPAPLSTKSFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPN SQ SGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLALKSKQHSSFGYGG SQ LQGPASGLNACQYNS XX SC translated from EMBL:U54499 XX FT 88 148 PS50071; HOMEOBOX_2. FT 90 146 PS50552; PAX. FT 90 152 SM00389; HOX_1. FT 91 147 PF00046; Homeobox domain. FT 151 281 Pit-1 interacting domain [1]. FT 281 294 PS50803; OAR. XX IN T08587 c-Jun; mouse, Mus musculus. IN T10042 Pit-1; Mammalia. IN T02410 pitx2; mouse, Mus musculus. IN T25960 pitx2C-beta; mouse, Mus musculus. IN T04096 Smad3-isoform1; human, Homo sapiens. IN T18411 Tbx19; mouse, Mus musculus. XX MX M01484 V$PITX1_01. MX M07055 V$PITX1_Q4. MX M01826 V$PITX1_Q6. MX M08895 V$PITX_Q4. XX BS R32851. BS R33001. BS R32849. BS R32841. BS R33023. BS R33024. BS R22965. BS R22966. BS R22967. BS R04992. XX DR TRANSPATH: MO000080631. DR EMBL: U54499; DR EMBL: U71206; DR UniProtKB: P70314; XX RN [1]; RE0006817. RX PUBMED: 8755540. RA Szeto D. P., Ryan A. K., O Connell S. M., Rosenfeld M. G. RT P-OTX: A PIT-1-interacting homeodomain factor expressed during anterior pituarity gland development RL Proc. Natl. Acad. Sci. USA 93:7706-7710 (1996). RN [2]; RE0047640. RX PUBMED: 15226417. RA Jeong K. H., Chin W. W., Kaiser U. B. RT Essential role of the homeodomain for pituitary homeobox 1 activation of mouse gonadotropin-releasing hormone receptor gene expression through interactions with c-Jun and DNA. RL Mol. Cell. Biol. 24:6127-6139 (2004). RN [3]; RE0068203. RX PUBMED: 18339718. RA Lamba P., Khivansara V., D'Alessio A. C., Santos M. M., Bernard D. J. RT Paired-like homeodomain transcription factors 1 and 2 regulate follicle-stimulating hormone beta-subunit transcription through a conserved cis-element. RL Endocrinology 149:3095-3108 (2008). RN [4]; RE0068206. RX PUBMED: 12970370. RA Maira M., Couture C., Le Martelot G., Pulichino A. M., Bilodeau S., Drouin J. RT The T-box factor Tpit recruits SRC/p160 co-activators and mediates hormone action. RL J. Biol. Chem. 278:46523-46532 (2003). XX //