TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T02410 XX ID T02410 XX DT 16.04.1998 (created); ewi. DT 24.01.2012 (updated); grs. CO Copyright (C), QIAGEN. XX FA pitx2 XX SY Otlx2; Pitx2; Ptx-2; Ptx2; RGS; RIEG. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G002666 Pitx2. XX CL C0006; homeo; 3.1.3.19.2.1. XX SZ 271 AA; 30.3 kDa (cDNA) (calc.). XX SQ METNCRKLVSACVQLEKDKGQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQLQELEATFQR SQ NRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGLMQP SQ YDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSPPNSISSMSMSSSM SQ VPSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNSSLASLRL SQ KAKQHSSFGYASVQNPASNLSACQYAVDRPV XX SC Swiss-Prot#P97474-3 XX FT 37 97 PS50071; HOMEOBOX_2. FT 39 95 PS50552; PAX. FT 39 101 SM00389; HOX_1. FT 40 96 PF00046; Homeobox domain. FT 228 248 PF03826; OAR domain. FT 233 246 PS50803; OAR. XX EX brain,,,Theiler Stage 22; detectable; RT-PCR; RNA (undefined); [5]. EX brain,,,adult; detectable; RT-PCR; RNA (undefined); [5]. EX eye and related structures (right and left),,,Theiler Stage 21; detectable; RT-PCR; RNA (undefined); [5]. EX heart,,,adult; detectable; RT-PCR; RNA (undefined); [5]. EX kidney (right and left),,,adult; detectable; RT-PCR; RNA (undefined); [5]. EX liver,,,adult; none; RT-PCR; RNA (undefined); [5]. EX lung,,,adult; detectable; RT-PCR; RNA (undefined); [5]. EX mouse, Mus musculus,,,Theiler Stage 10; none; RT-PCR; RNA (undefined); [5]. EX mouse, Mus musculus,,,Theiler Stage 18; detectable; RT-PCR; RNA (undefined); [5]. EX mouse, Mus musculus,,,Theiler Stage 23; detectable; RT-PCR; RNA (undefined); [5]. EX mouse, Mus musculus,,,Theiler Stage 25; detectable; RT-PCR; RNA (undefined); [5]. EX muscles,,,adult; detectable; RT-PCR; RNA (undefined); [5]. EX spleen,,,adult; none; RT-PCR; RNA (undefined); [5]. EX testis (right and left),,,adult; detectable; RT-PCR; RNA (undefined); [5]. XX FF for expression in teeth, see [4]; FF rescues unc-30 T03371 mutant phenotype of C. elegans [6]; FF regulator of GABAergic differentiation during neural development [6]; XX IN T08862 pitx1; mouse, Mus musculus. XX MX M01447 V$PITX2_01. MX M00482 V$PITX2_Q2. MX M07056 V$PITX2_Q4. MX M02114 V$PITX2_Q6. MX M08895 V$PITX_Q4. XX BS R11015. BS R11016. XX DR TRANSPATH: MO000026397. DR EMBL: U70132; DR EMBL: U80011; DR EMBL: U80036; DR UniProtKB: P97474-3; XX RN [1]; RE0006808. RX PUBMED: 8944018. RA Semina E. V., Reiter R., Leysens N. J., Alward W. L. M., Small K. W., Datson N. A., Siegle-Bartelt J., Bierke-Nelson D., Bitoun P., Zabel B. U., Carey J. C., Murray J. C. RT Cloning and characterization of a novel bicoid-related homeobox transcription factor gene, RIEG, involved in Rieger syndrome RL Nat. Genet. 14:392-399 (1996). RN [2]; RE0006809. RX PUBMED: 9147650. RA Gage P. J., Camper S. A. RT Pituitary homeobox 2, a novel member of the bicoid-related family of homeobox genes, is a potential regulator of anterior structure formation RL Hum. Mol. Genet. 6:457-464 (1997). RN [3]; RE0006813. RX PUBMED: 9299120. RA Mucchielli M. L., Mitsiadis T. A., Raffo S., Brunet J. F., Proust J. P., Goridis C. RT Mouse Otlx2/RIEG expression in the odontogenic epithelium precedes tooth initiation and requires mesenchyme-derived signals for its maintenance RL Dev. Biol. 189:275-284 (1997). RN [4]; RE0014825. RA Pekkanen M., Nieminen P., Sahlberg C., Aberg T., Thesleff I. RT Gene expression in tooth (WWW database); URL: http://bite-it.helsinki.fi/OTLX2.htm RL Internet : (1996). RN [5]; RE0016847. RX PUBMED: 11157981. RA Hjalt T. A., Amendt B. A., Murray J. C. RT PITX2 regulates procollagen lysyl hydroxylase (PLOD) gene expression: implications for the pathology of Rieger syndrome RL J. Cell Biol. 152:545-552 (2001). RN [6]; RE0016849. RX PUBMED: 11517269. RA Westmoreland J. J., McEwen J., Moore B. A., Jin Y., Condie B. G. RT Conserved function of Caenorhabditis elegans UNC-30 and mouse Pitx2 in controlling GABAergic neuron differentiation RL J. Neurosci. 21:6810-6819 (2001). XX //