TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09240 XX ID T09240 XX DT 17.08.2006 (created); din. DT 17.08.2006 (updated); din. CO Copyright (C), QIAGEN. XX FA HOXD12 XX SY Chox-4.7; Chox-4F; GHox-4.7; HOX4H (human). XX OS chick, Gallus gallus OC eukaryota; animalia; metazoa; chordata; vertebrata; aves; neornithes; neognathae; galliformes; phasianidae XX GE G037192 HOXD12. XX CL C0006; homeo. XX SZ 266 AA; 30.0 kDa (cDNA) (calc.). XX SQ MCDRSLYRSGYVGSLLNLQSPDSFYFPNLRANGSQLAALPTISYPRSSIPWTCPSPCAAQ SQ PQGHAFGGAAQPYLPGSVPISISSNSNKECLEENSKYYAHDASSKQEERCRQRQSFANDP SQ TITHAANLKPAKYDHSSLPRSLHGSAALFEVNSCTSSLKEDIKNSVNLNLTVQPAAVQSC SQ LRPSVQDGLPWCPTQGRSRKKRKPYTKQQIAELENEFLLNEFINRQKRKELSNRLNLSDQ SQ QVKIWFQNRRMKKKRVVMREQALSMY XX SC Swiss-Prot#P24343 XX FT 196 256 PS50071; HOMEOBOX_2. FT 198 260 SM00389; HOX_1. FT 199 255 PF00046; Homeobox domain. XX IN T08461 c-Jun; human, Homo sapiens. IN T09239 MafB; chick, Gallus gallus. IN T09242 MafF; chick, Gallus gallus. IN T09243 MafG; chick, Gallus gallus. IN T09241 MafK; chick, Gallus gallus. XX DR TRANSPATH: MO000085169. DR EMBL: D10289; GGCHOX4F1. DR UniProtKB: P24343; HXDC_CHICK. XX RN [1]; RE0004068. RX PUBMED: 1673231. RA Izpisua-Belmonte J. C., Tickle C., Dolle P., Wolpert L., Duboule D. RT Expression of the homeobox Hox-4 genes and the specification of position in chick wing development RL Nature 350:585-589 (1991). RN [2]; RE0004072. RX PUBMED: 1672266. RA Nohno T., Noji S., Koyama E., Ohyama K., Myokai F., Kuroiwa A., Saito T., Taniguchi S. RT Involvement of the Chox 4 chicken homeobox genes in determination of anteroposterior axial polarity during limb development RL Cell 64:1197-1205 (1991). RN [3]; RE0004076. RX PUBMED: 1682126. RA Mackem S., Mahon K. A. RT GHox-4.7: A chick homeobox gene expressed primarily in limb buds with limb-type differences in expression RL Development 112:791-806 (1991). RN [4]; RE0047971. RX PUBMED: 11036080. RA Kataoka K., Yoshitomo-Nakagawa K., Shioda S., Nishizawa M. RT A set of Hox proteins interact with the Maf oncoprotein to inhibit its DNA binding, transactivation, and transforming activities. RL J. Biol. Chem. 276:819-826 (2001). XX //