TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09243 XX ID T09243 XX DT 17.08.2006 (created); din. DT 15.06.2009 (updated); smt. CO Copyright (C), QIAGEN. XX FA MafG XX SY Transcription factor MafG. XX OS chick, Gallus gallus OC eukaryota; animalia; metazoa; chordata; vertebrata; aves; neornithes; neognathae; galliformes; phasianidae XX GE G063388 MAFG. XX CL C0008; bZIP. XX SZ 162 AA; 18.1 kDa (gene) (calc.). XX SQ MTTPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIIQLKQRRRTLK SQ NRGYAASCRVKRVTQKEELEKQKAELQQEVEKLASENASMKMELDALRSKYEALQNFART SQ VARSPVTPVRGPLTSSMGPLVPGKVATTSVITIVKSKTDARS XX SC translated from EMBL #D28602 XX FT 22 116 PF03131; bZIP Maf transcription factor. FT 46 113 SM00338; brlzneu. FT 51 114 PS50217; BZIP. XX IN T09240 HOXD12; chick, Gallus gallus. IN T10334 Nrf3; mouse, Mus musculus. XX MX M07048 V$MAFG_Q3. MX M07296 V$MAF_Q4. MX M00983 V$MAF_Q6_01. MX M00284 V$TCF11MAFG_01. XX BS R12541. BS R12542. BS R12543. BS R12544. BS R12545. BS R12546. BS R12547. BS R12548. BS R12549. BS R12550. BS R12551. BS R12552. BS R12553. BS R12554. BS R12555. BS R12556. BS R12557. BS R12558. BS R12559. BS R12560. BS R12561. BS R12562. BS R12563. BS R12564. BS R12565. BS R12566. BS R12567. BS R12568. BS R12569. BS R12570. BS R12571. BS R12572. BS R12573. BS R12574. BS R12575. BS R12576. XX DR TRANSPATH: MO000085181. DR EMBL: D28601; GGMAFA. DR EMBL: D28602; DR UniProtKB: Q90889; XX RN [1]; RE0003519. RX PUBMED: 7891713. RA Kataoka K., Igarashi K., Itoh K., Fujiwara K. T., Noda M., Yamamoto M., Nishizawa M. RT Small Maf protein heterodimerize with Fos and may act as competetive repressor of the NF-E2 transcription factor RL Mol. Cell. Biol. 15:2180-2190 (1995). RN [2]; RE0003520. RX PUBMED: 8361754. RA Fujiwara K. T., Kataoka K., Nishizawa M. RT Two new members of the maf oncogene family, mafK and mafF, encode nuclear b-Zip proteins lacking putative trans-activator domain RL Oncogene 8:2371-2380 (1993). RN [3]; RE0003522. RX PUBMED: 8107826. RA Igarashi K., Kataoka K., Itoh K., Hayashi N., Nishizawa M., Yamamoto M. RT Regulation of transcription by dimerization of erythroid factor NF-E2 p45 with small Maf proteins RL Nature 367:568-572 (1994). RN [4]; RE0006838. RX PUBMED: 9421508. RA Johnsen O., Murphy P., Prydz H., Kolsto A.-B. RT Interaction of the CNC-bZIP factor TCF11/LCR-F1/Nrf1 with MafG: binding-site selection and regulation of transcription RL Nucleic Acids Res. 26:512-520 (1998). RN [5]; RE0047971. RX PUBMED: 11036080. RA Kataoka K., Yoshitomo-Nakagawa K., Shioda S., Nishizawa M. RT A set of Hox proteins interact with the Maf oncoprotein to inhibit its DNA binding, transactivation, and transforming activities. RL J. Biol. Chem. 276:819-826 (2001). XX //