TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09242 XX ID T09242 XX DT 17.08.2006 (created); din. DT 15.06.2009 (updated); smt. CO Copyright (C), QIAGEN. XX FA MafF XX SY Maff. XX OS chick, Gallus gallus OC eukaryota; animalia; metazoa; chordata; vertebrata; aves; neornithes; neognathae; galliformes; phasianidae XX GE G037195 MAFF. XX CL C0008; bZIP. XX SZ 149 AA; 16.6 kDa (cDNA) (calc.), 20 kDa (SDS) [2] XX SQ MAADGLSSKALKVKRELGENTPLLSDEELMGLSVRELNHHLRGLSKEEVARLKQRRRTLK SQ NRGYAASCRVKRVCQKEELQKQKMELEWEVDKLARENAAMRLELDTLRGKYEALQGFART SQ VAAHGPPAKVATASVITIVKSGANQAAYS XX SC translated from EMBL #D16184 XX FT 22 116 PF03131; bZIP Maf transcription factor. FT 49 113 SM00338; brlzneu. FT 51 114 PS50217; BZIP. XX IN T09240 HOXD12; chick, Gallus gallus. XX DR TRANSPATH: MO000085178. DR EMBL: D16182; GD901A. DR EMBL: D16183; GD901B. DR EMBL: D16184; DR UniProtKB: Q90595; XX RN [1]; RE0003519. RX PUBMED: 7891713. RA Kataoka K., Igarashi K., Itoh K., Fujiwara K. T., Noda M., Yamamoto M., Nishizawa M. RT Small Maf protein heterodimerize with Fos and may act as competetive repressor of the NF-E2 transcription factor RL Mol. Cell. Biol. 15:2180-2190 (1995). RN [2]; RE0003520. RX PUBMED: 8361754. RA Fujiwara K. T., Kataoka K., Nishizawa M. RT Two new members of the maf oncogene family, mafK and mafF, encode nuclear b-Zip proteins lacking putative trans-activator domain RL Oncogene 8:2371-2380 (1993). RN [3]; RE0003522. RX PUBMED: 8107826. RA Igarashi K., Kataoka K., Itoh K., Hayashi N., Nishizawa M., Yamamoto M. RT Regulation of transcription by dimerization of erythroid factor NF-E2 p45 with small Maf proteins RL Nature 367:568-572 (1994). RN [4]; RE0047971. RX PUBMED: 11036080. RA Kataoka K., Yoshitomo-Nakagawa K., Shioda S., Nishizawa M. RT A set of Hox proteins interact with the Maf oncoprotein to inhibit its DNA binding, transactivation, and transforming activities. RL J. Biol. Chem. 276:819-826 (2001). XX //