TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09531 XX ID T09531 XX DT 30.10.2006 (created); kau. DT 06.02.2015 (updated); sup. CO Copyright (C), QIAGEN. XX FA ATF-4 XX SY activating transcription factor 4; ATF-4; ATF4; C/ATF; CREB-2; hCREB2; TAXREB67; TAXREB67 homolog; TR67; YAVREB67. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G002874 ATF4; HGNC: ATF4. XX CL C0008; bZIP. XX SZ 351 AA; 38.6 kDa (cDNA) (calc.). XX SQ MTEMSFLSSEVLVGDLMSPFDPSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSE SQ WLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTC SQ DLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSL SQ ELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRG SQ SPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKR SQ AEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP XX SC Swiss-Prot#P18848 XX FT 249 351 repressor activity [3]. FT 276 340 PF00170; bZIP transcription factor. FT 276 340 SM00338; brlzneu. FT 278 341 PS50217; BZIP. XX IN T01313 ATF-3-isoform1; human, Homo sapiens. IN T18798 ATFa-isoform3; human, Homo sapiens. IN T18808 B-ATF; human, Homo sapiens. IN T18804 batf3; human, Homo sapiens. IN T08776 c-Fos; human, Homo sapiens. IN T19051 c-MAF-isoform2; human, Homo sapiens. IN T00105 C/EBPalpha; human, Homo sapiens. IN T06595 C/EBPbeta-FL; human, Homo sapiens. IN T09139 C/EBPdelta; human, Homo sapiens. IN T04883 C/EBPepsilon; human, Homo sapiens. IN T09524 C/EBPgamma; human, Homo sapiens. IN T09526 CHOP-10-isoform1; human, Homo sapiens. IN T09550 CREBPA-Alpha; human, Homo sapiens. IN T05984 FosB; human, Homo sapiens. IN T09569 Hlf-isoform1; human, Homo sapiens. IN T18466 IRF-7; Mammalia. IN T01599 Nfe2l1-xbb1; human, Homo sapiens. IN T27866 Zhangfei; human, Homo sapiens. XX MX M00514 V$ATF4_Q2. MX M07246 V$ATF4_Q5. MX M01864 V$ATF4_Q6. MX M00981 V$CREBATF_Q6. MX M00801 V$CREB_Q3. XX BS R03924. BS R11554. BS R03906. BS R00207. BS R56308. BS R56309. BS R66102. BS R62945. BS R62947. BS R03916. BS R26801. BS R01358. XX DR TRANSPATH: MO000089817. DR EMBL: AL022312; HS1104E15. DR EMBL: D90209; HSYAVREB. DR EMBL: M86842; HSCREB2A. DR UniProtKB: P18848; ATF4_HUMAN. XX RN [1]; RE0000666. RX PUBMED: 2516827. RA Hai T., Liu F., Coukos W. J., Green M. R. RT Transcription factor ATF cDNA clones: an extensive family of leucine zipper proteins able to selectively form DNA-binding heterodimers RL Genes Dev. 3:2083-2090 (1989). RN [2]; RE0000787. RX PUBMED: 8504929. RA Vinson C. R., Hai T., Boyd S. M. RT Dimerization specificity of the leucine zipper-containing bZIP motif on DNA binding: prediction and rational design RL Genes Dev. 7:1047-1058 (1993). RN [3]; RE0002560. RX PUBMED: 1534408. RA Karpinski B. A., Morle G. D., Huggenvik J., Uhler M. D., Leiden J. M. RT Molecular cloning of human CREB-2: An ATF/CREB transcription factor that can negatively regulate transcription from the cAMP response element RL Proc. Natl. Acad. Sci. USA 89:4820-4824 (1992). RN [4]; RE0002561. RX PUBMED: 1827203. RA Hai T., Curran T. RT Cross-family dimerization of transcription factors Fos/Jun and ATF/CREB alters DNA binding specificity RL Proc. Natl. Acad. Sci. USA 88:3720-3724 (1991). RN [5]; RE0003154. RX PUBMED: 1847461. RA Tsujimoto A., Nyunoya H., Morita T., Sato T., Shimotohno K. RT Isolation of cDNAs for DNA-Binding Proteins Which Specifically Bind to a tax-Responsive Enhancer Element in the Long Terminal Repeat of Human T-Cell Leukemia Virus Type I RL J. Virol. 65:1420-1426 (1991). RN [6]; RE0004521. RX PUBMED: 7692236. RA Kaszubska W., Hooft van Huijsduijnen R., Ghersa P., DeRaemy-Schenk A.-M., Chen B. P. C., Hai T., DeLamarter J. F., Whelan J. RT Cyclic AMP-independent ATF family members interact with NF-kappaB and function in the activation of the E-selectin promoter in response to cytokines RL Mol. Cell. Biol. 13:7180-7190 (1993). RN [7]; RE0017064. RX PUBMED: 11038375. RA Lim C., Sohn H., Gwack Y., Choe J. RT Latency-associated nuclear antigen of Kaposi's sarcoma-associated herpesvirus (human herpesvirus-8) binds ATF4/CREB2 and inhibits its transcriptional activation activity RL J. Gen. Virol. 81:2645-2652 (2000). RN [8]; RE0048287. RX PUBMED: 12805554. RA Newman J. R., Keating A. E. RT Comprehensive identification of human bZIP interactions with coiled-coil arrays. RL Science 300:2097-2101 (2003). RN [9]; RE0070798. RX PUBMED: 21148039. RA Liang Q., Deng H., Sun C. W., Townes T. M., Zhu F. RT Negative regulation of IRF7 activation by activating transcription factor 4 suggests a cross-regulation between the IFN responses and the cellular integrated stress responses. RL J. Immunol. 186:1001-1010 (2011). XX //