TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T09554 XX ID T09554 XX DT 31.10.2006 (created); kau. DT 10.11.2006 (updated); kau. CO Copyright (C), QIAGEN. XX FA DBP XX SY Albumin D box-binding protein; D-site-binding protein. XX OS human, Homo sapiens OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; primates XX GE G002908 DBP; HGNC: DBP. XX CL C0008; bZIP. XX SZ 325 AA; 34.3 kDa (cDNA) (calc.). XX SQ MARPVSDRTPAPLLLGGPAGTPPGGGALLGLRSLLQGTSKPKEPASCLLKEKERKAALPA SQ ATTPGPGLETAGPADAPAGAVVGGGSPRGRPGPVPAPGLLAPLLWERTLPFGDVEYVDLD SQ AFLLEHGLPPSPPPPGGPSPEPSPARTPAPSPGPGSCGSASPRSSPGHAPARAALGTASG SQ HRAGLTSRDTPSPVDPDTVEVLMTFEPDPADLALSSIPGHETFDPRRHRFSEEELKPQPI SQ MKKARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQE SQ VVAVRQELSHYRAVLSRYQAQHGAL XX SC translated from EMBL #U06936 XX FT 253 317 SM00338; brlzneu. FT 254 307 PF07716; Basic region leucine zipper. FT 255 318 PS50217; BZIP. XX IN T18808 B-ATF; human, Homo sapiens. IN T18804 batf3; human, Homo sapiens. IN T06595 C/EBPbeta-FL; human, Homo sapiens. IN T09524 C/EBPgamma; human, Homo sapiens. IN T09526 CHOP-10-isoform1; human, Homo sapiens. IN T09569 Hlf-isoform1; human, Homo sapiens. IN T04876 TEF-xbb1; human, Homo sapiens. XX MX M00624 V$DBP_Q6. MX M01872 V$DBP_Q6_01. MX M07038 V$DBP_Q6_02. XX DR TRANSPATH: MO000090062. DR EMBL: D28468; DR EMBL: U06936; DR EMBL: U48212; DR EMBL: U48213; DR EMBL: U79283; DR UniProtKB: Q10586; XX RN [1]; RE0000315. RX PUBMED: 2767055. RA Cleat P. H., Hay R. T. RT Co-operative interactions between NFI and the adenovirus DNA binding protein at the adenovirus origin of replication RL EMBO J. 8:1841-1848 (1989). RN [2]; RE0017142. RX PUBMED: 7835883. RA Khatib Z. A., Inaba T., Valentine M., Look A. T. RT Chromosomal localization and cDNA cloning of the human DBP and TEF genes RL Genomics 23:344-351 (1994). RN [3]; RE0017143. RX PUBMED: 8786133. RA Shutler G., Glassco T., Kang X., Korneluk R., Mueller C. R. RT Genomic structure of the human D-site binding protein (DBP) gene RL Genomics 34:334-339 (1996). RN [4]; RE0048287. RX PUBMED: 12805554. RA Newman J. R., Keating A. E. RT Comprehensive identification of human bZIP interactions with coiled-coil arrays. RL Science 300:2097-2101 (2003). XX //