TRANSFAC-Logo

TRANSFAC FACTOR TABLE, Release 2017.2 - public - 2017-06-30, (C) QIAGEN


AC T00244 AS T00455, T04214. XX ID T00244 XX DT 15.10.1992 (created); ewi. DT 04.08.2014 (updated); jtr. CO Copyright (C), QIAGEN. XX FA Egr-1 XX SY early growth response protein 1; Early Growth Responsive protein 1; EGR1; Krox-24; NGFI-A; TIS-8; zif268. XX OS mouse, Mus musculus OC eukaryota; animalia; metazoa; chordata; vertebrata; tetrapoda; mammalia; eutheria; rodentia; myomorpha; muridae; murinae XX GE G000505 Egr1. XX CL C0001; CH. XX SZ 533 AA; 56.6 kDa (cDNA) (calc.), 54, 84 kDa (SDS) XX SQ MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGTPEGSGG SQ NSSSSTSSGGGGGGGSNSGSSAFNPQGEPSEQPYEHLTTESFSDIALNNEKAMVETSYPS SQ QTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPTSSSSAPSPAASSSS SQ SASQSPPLSCAVPSNDSSPIYSAAPTFPTPNTDIFPEPQSQAFPGSAGTALQYPPPAYPA SQ TKGGFQVPMIPDYLFPQQQGDLSLGTPDQKPFQGLENRTQQPSLTPLSTIKAFATQSGSQ SQ DLKALNTTYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIH SQ TGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQK SQ DKKADKSVVASPAASSLSSYPSPVATSYPSPATTSFPSPVPTSYSSPGSSTYPSPAHSGF SQ PSPSVATTFASVPPAFPTQVSSFPSAGVSSSFSTSTGLSDMTATFSPRTIEIC XX SC Swiss-Prot#P08046 XX FT 336 360 PF00096; zf-C2H2. FT 336 360 SM00355; c2h2final6. FT 336 365 PS50157; ZINC_FINGER_C2H2_2. FT 366 388 PF00096; zf-C2H2. FT 366 388 SM00355; c2h2final6. FT 366 393 PS50157; ZINC_FINGER_C2H2_2. FT 394 416 PF00096; zf-C2H2. FT 394 416 SM00355; c2h2final6. FT 394 421 PS50157; ZINC_FINGER_C2H2_2. XX SF pI = 8.52; SF 3 zinc finger motifs; SF phosphorylation, glycosylation; SF crystal structure (co-crystals with 11-bp DNA); XX CP predom. in bone and cartilage (embryogenesis). XX FF two subunits, encoded by an immediate-early response gene, involved in signal transduction; FF early growth response gene; FF increased by retinoic acid in preosteoblastic cells; FF for expression in teeth, see [11]; FF enhanced susceptibility to TG-inducible apoptosis through induction of p53 by ectopic Egr-1 [13]; FF alternative translation initiation; XX IN T06595 C/EBPbeta-FL; human, Homo sapiens. IN T02370 Nab1; mouse, Mus musculus. XX MX M00243 V$EGR1_01. MX M02848 V$EGR1_04. MX M02744 V$EGR1_06. MX M07354 V$EGR1_Q3. MX M01873 V$EGR1_Q6. MX M08878 V$EGR_Q3. MX M00807 V$EGR_Q6. MX M00982 V$KROX_Q6. XX BS R04818. BS R04819. BS R04914. BS R73972. BS R02147. BS R73979. BS R24693. BS R24695. BS R24913. BS R24915. BS R04734. BS R10929. BS R24952. BS R24954. BS R04733. BS R04878. BS R04879. BS R04880. BS R04881. BS R04853. BS R26689. BS R14632. BS R24090. BS R04738. BS R04739. BS R03721. BS R31126. BS R01614. BS R01615. BS R01616. BS R00721. BS R29057. BS R29058. BS R15104. BS R04893. BS R04894. BS R04913. BS R14686. BS R04748. BS R04749. BS R09545. BS R09547. BS R24218. BS R29653. XX DR TRANSPATH: MO000024798. DR TRANSCOMPEL: C00213. DR TRANSCOMPEL: C00214. DR TRANSCOMPEL: C00216. DR TRANSCOMPEL: C00223. DR EMBL: M20157; DR EMBL: M22326; DR EMBL: M28844; MMKROX2S1. DR EMBL: M28845; DR UniProtKB: P08046; XX RN [1]; RE0000235. RX PUBMED: 3127059. RA Sukhatme V. P., Cao X., Chang L. C., Tsai-Morris C.-H., Stamenkovich D., Ferreira P. C. P., Cohen D. R., Edwards S. A., Shows T. B., Curran T., Le Beau M. M., Adamson E. D. RT A zinc finger-encoding gene coregulated with c-fos during growth and differentiation, and after cellular depolarization RL Cell 53:37-43 (1988). RN [2]; RE0001008. RX PUBMED: 2118523. RA Day M. L., Fahrner T. J., Ayken S., Milbrandt J. RT The zinc finger protein NGFI-A exists in both nuclear and cytoplasmic forms in nerve growth factor-stimulated PC12 cells RL J. Biol. Chem. 265:15253-15260 (1990). RN [3]; RE0001009. RX PUBMED: 2071571. RA Gupta M. P., Gupta M., Zak R., Sukhatme V. P. RT Egr-1, a serum-inducible zinc finger protein, regulates transcription of the rat cardiac alpha-myosin heavy chain gene RL J. Biol. Chem. 266:12813-12816 (1991). RN [4]; RE0001470. RX PUBMED: 1708092. RA Suva L. J., Ernst M., Rodan G. A. RT Retinoic acid increases zif268 early gene expression in rat preosteoblastic cells RL Mol. Cell. Biol. 11:2503-2510 (1991). RN [5]; RE0002409. RX PUBMED: 2510170. RA Christy B., Nathans D. RT DNA binding site of the growth factor-inducible protein Zif268 RL Proc. Natl. Acad. Sci. USA 86:8737-8741 (1989). RN [6]; RE0002514. RX PUBMED: 3133658. RA Lemaire P., Revelant O., Bravo R., Charnay P. RT Two mouse genes encoding potential transcription factors with identical DNA-binding domains are activated by growth factors in cultured cells RL Proc. Natl. Acad. Sci. USA 85:4691-4695 (1988). RN [7]; RE0002690. RX PUBMED: 3672127. RA Milbrandt J. RT A nerve-growth factor-induced gene encodes a possible transcriptional regulatory factor RL Science 238:797-799 (1987). RN [8]; RE0002691. RX PUBMED: 2028256. RA Pavletich N. P., Pablo C. O. RT Zinc finger-DNA recognition: Crystal structure of a Zif268-DNA complex at 2.1 A RL Science 252:809-816 (1991). RN [9]; RE0002755. RX PUBMED: 2109185. RA Cao X., Koski R. A., Gashler A., McKiernan M., Morris C. F., Gaffney R., Hay R. V., Sukhatme V. P. RT Identfication and characterization of the Egr-1 gene product, a DNA-binding zinc finger protein induced by differentiation and growth signals RL Mol. Cell. Biol. 10:1931-1939 (1990). RN [10]; RE0002757. RX PUBMED: 2113174. RA Lemaire P., Vesque C., Schmitt J., Stunnenberg H., Frank R., Charnay P. RT The serum-inducible mouse gene Krox-24 encodes a sequence-specific transcriptional activator RL Mol. Cell. Biol. 10:3456-3467 (1990). RN [11]; RE0014809. RA Pekkanen M., Nieminen P., Sahlberg C., Aberg T., Thesleff I. RT Gene expression in tooth (WWW database); URL: http://bite-it.helsinki.fi/EGR1.htm RL Internet : (1996). RN [12]; RE0016661. RX PUBMED: 10318795. RA Dorn C., Ou Q., Svaren J., Crawford P. A., Sadovsky Y. RT Activation of luteinizing hormone beta gene by gonadotropin-releasing hormone requires the synergy of early growth response-1 and steroidogenic factor-1. RL J. Biol. Chem. 274:13870-13876 (1999). RN [13]; RE0016822. RX PUBMED: 9242687. RA Nair P., Muthukkumar S., Sells S. F., Han S. S., Sukhatme V. P., Rangnekar V. M. RT Early growth response-1-dependent apoptosis is mediated by p53. RL J. Biol. Chem. 272:20131-20138 (1997). RN [14]; RE0030566. RX PUBMED: 12947119. RA Zhang F., Lin M., Abidi P., Thiel G., Liu J. RT Specific interaction of Egr1 and c/EBPbeta leads to the transcriptional activation of the human low density lipoprotein receptor gene. RL J. Biol. Chem. 278:44246-54 (2003). XX //